SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340100.Bpet0584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340100.Bpet0584
Domain Number 1 Region: 723-965
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.1e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 2 Region: 26-212
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000129
Family Pyruvate oxidase and decarboxylase Pyr module 0.078
Further Details:      
 
Domain Number 3 Region: 435-618
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000126
Family Pyruvate oxidase and decarboxylase PP module 0.085
Further Details:      
 
Domain Number 4 Region: 274-362
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000968
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 340100.Bpet0584
Sequence length 1168
Comment (Bordetella petrii)
Sequence
MDGTPAAEPALDLDYQLQDNLTRTRGRVFLTGTQALVRVLLAQRRLDRERGLNTAGFVSG
YRGSPLGGVDMAMWKARPILDAHQITFVPGINEDMAATAVMGTQQAGVRADRKVDGVFAL
WYGKGPGVDRAGDALHHGNAAGASRHGGVLVVVGDDHTAVSSSIPHASEASLIGWQMPIV
HPASIEEYETFALWGWALSRYSGAWVAFKAISETVESGQAYTPAPPARYDMPADPDLPPE
ALEYTARDFLSPAVELRMQKRLRAVRAFARRHSIDRLVCAAPHARVGLVTVGKAHLDTLE
ALARLGIDPWAADTPVRIYKPGLTWPLDAGRLHDFARGLSHILVIEEKGAVVEGQIKDLL
YNLPARPGVAGKTGLDGEPLVPSAGQLRPSLLAAPLAAWLARTAGLRSAADPAALACPAP
LSNDADGMRRRPYFCSGCPHNSSTKVPEGSQALAGVGCHYMAAWMDRDTGGLTQMGGEGA
DWIGLSRYIEMPHVFQNMGEGTYYHSGYLAIRQAVAARANITYKILFNDAVAMTGGQPVD
GPISVPQICQQLRGENVARIVVTTDEPAKYQGVELPAGVTVHHRRELDALQRELRATPGV
TVLIHDQTCAAEKRRRRKKQQFPDPPRRLLINSAVCEGCGDCGVQSNCLSIVPLETPYGR
KRAIDQSSCNKDYSCAEGFCPSFVSVLDGTLRKRAAPTPGAPAWRRHLDALPLPPAHAPE
QPYRMLVAGMGGTGVITIGAIVSVAAHLQGLSASVLDLTGLAQKGGTVVSHIRLAPPHAP
EGPVRLDWQQADAAILCDPVAAVAPDSLGALRRGHTQVVVNTYVAPVSEFTRNPDAALRP
EALLAKIRHAAGEARTAALDAHQAALALFGDSILSNMFMLGYAWQRGAVPLSHAALARAI
ELNGVAVQANRDAFEAGRLAAHQPQALEDALRPAAQVVQLHVPESFERAVARRERDLTAY
QNAAYARQYRELVDRVAQRERELAPTARTPRLAMAVARSLFKLMAYKDEYEVARLYTDGS
FRQQLREQFEDGYTLRFHMAPPLLARKDPHTGIPRKLALGPAAWPAMRLLARLKGLRGTW
LDPFGHSAERRMERQLIQEYRQTVETLLKHLSPANLVQAAGIAALPEQVRGFGHVKVASV
THYRQRLEQMLQHYGPSGSPAVSARKSA
Download sequence
Identical sequences A9I206
340100.Bpet0584 gi|163854889|ref|YP_001629187.1| WP_012247606.1.34756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]