SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340100.Bpet2356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340100.Bpet2356
Domain Number 1 Region: 44-235
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.23e-24
Family Clp protease, ClpP subunit 0.082
Further Details:      
 
Domain Number 2 Region: 406-471
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000157
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340100.Bpet2356
Sequence length 480
Comment (Bordetella petrii)
Sequence
MPHSGSRHLPCASHCAGLLCAIAWLWVAMAAFMSAPARAQATSAPPGQSAPVVVLQLQGA
VGPATTEYLRHGLADANARRAAAVVLRIDTPGGLASSMRDIVRAIIASPVPVIGYVAPGG
ARAASAGTYILYACHLAAMAPGTNLGAATPIPLGPDSRPRNEDHGKAETDPGGKPADAAP
PPHDSKAVNDAAALIRSLADMRGRNAEWAEQAVRGAASLAAREALQQKVIDLVADDLHDL
LRRADGRELRANASVITLATRDAAVLELQPDWRTRVLAVITDPNIAYILLLLGIYGILFE
MMNPGAILPGALGAVALVTALFALNMLPVSYAGLGLVLLGIALMAAEAFTPTLGLLGAAG
LALFAFGSLFLYDTHGAGFALSVPLVATAAAASALLLFLIFFVALRAQRRRVVSDGSTQA
GQAVQVLSWHGHGGLVRAGAETWEARADAPLRPGEQAIIESRQGLVLHVRPASSIPKEST
Download sequence
Identical sequences A9IME4
340100.Bpet2356 WP_012249267.1.34756 gi|163856669|ref|YP_001630967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]