SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340100.Bpet3349 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340100.Bpet3349
Domain Number 1 Region: 117-373
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.75e-64
Family D-glucarate dehydratase-like 0.000000589
Further Details:      
 
Domain Number 2 Region: 4-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.8e-32
Family Enolase N-terminal domain-like 0.00000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 340100.Bpet3349
Sequence length 380
Comment (Bordetella petrii)
Sequence
MESIRIETVEAILVDLPTIRAHQLAMAVMQRQTLVIVRLRCSDGVEGLGEATTIGGLSYG
EESPEGIKLAIDTYLAPALVGQDATNARAALARLEKVARGNRFAKSALETALLDAQGKRL
DVPVATLLGGAVRSRLPVLWTLASGDTARDIDEAEALLQSRRHNTFKLKIGRRDVASDVA
HVSRIKQALGDRARVTVDVNQAWDEAEAAGAIARLEAAGVDLIEQPIPRANLAGMARLAA
RFVVPIMADEAVCTPEDALDIARLGAADVLALKIAKSGGILEMGRTAAVGDAAGMALYGG
TMLEGSIGSVASAHGFATLPRLAWGTELFGPLLLKDDIVAVRPVYDDFSLELPAGPGLGL
ALDEDKLAFYRRDRAAARGA
Download sequence
Identical sequences A9HX10
gi|163857661|ref|YP_001631959.1| 340100.Bpet3349 WP_012250247.1.34756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]