SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_0014 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_0014
Domain Number 1 Region: 6-177
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.22e-25
Family Clp protease, ClpP subunit 0.063
Further Details:      
 
Domain Number 2 Region: 362-425
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000262
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_0014
Sequence length 427
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MRIAILLLLVAFSYAYVATSVYVVEINGVVGPYTYSQIQRAISLAEQNNGLVLILLSTPG
GLADPTLQIIREIGNSPVPVVGYVYPDYSYAWSAGTYILLSTHIAAMAPHTVIGSCQPIS
GGTPVNESKILNALIGYLETVSKSYGRNGTFARLCITQNINLDAETALKYRVIDVVATGV
DDLLKKINGMTVLLRNQQTELVVESPVIRRVEPSLTETLQMWLSDPVMSSVLSLLAFLLL
LAAFITGHPAAAVAAIVLLVISMFSILPTAWLGLALIIMGAVLILAEILMGMAAHGAVAG
VGAVLLVVGFLSAYPANVFSGELIHIRDWWLIQLGLYVNIAILLGFLVFVVYKAVIIHKQ
RPPSEILTTLKGAEGVAVDDIGPGSPGFVIVFGEYWRAVSDTPVKKGCRIRVVEIAGEIL
KIEPVQC
Download sequence
Identical sequences A4WGW4
340102.Pars_0014 gi|145590281|ref|YP_001152283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]