SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_0139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_0139
Domain Number 1 Region: 235-503
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.86e-53
Family Pyruvate oxidase and decarboxylase Pyr module 0.069
Further Details:      
 
Domain Number 2 Region: 518-620
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.022
Further Details:      
 
Domain Number 3 Region: 2-256
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000288
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_0139
Sequence length 633
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MKINFLIGGPQGRGVETASFMFIYGVGSAGYYVFARREFWSNIAGGRHSYVVGSISESWP
APAPGNSVDLALTFDGHAVLEHVFHLRRGSYLVYNTEEDSKTPDSYTMMSKALAERLKNF
AKEHGFEPTVKGYVEYLRQNGVEIIGLPYNKHITEIGRKIGVTSPVMLARFVNTFVVALG
AALLGLSEEHVASGVGFALGKKAEVIEQNKKVASEAMKLVEKRVATLQQRNPQTKRVFWN
GNEASAYGKIVGGVRFVAYYPITPATDDAMTFERLMPYPVSKNADELSKYEKIGSVAFQA
EDELAAIAIATGGAIAGARSATVTSGPGFSLMAEALSLAGMMEVGVVVTLWMRSGPSTGQ
ATRQAQQDLLFSLFIGHGEYPKIVYASGDLEEVFFDNIKVANWAERYRVPVIHLVDKNLS
NTFAVMPLPDISKAKITTVKPVVYPQTQEAEAYPLDEIVAPKLLPGISNAIFHLNSLEHD
PEGDPEEDPVVVTKMFEKRMAKIRLIEGEIPPEEKVLYFGPKDAEKVIVGWGSTKPAILT
ALDELKDVGFLYVKMLYPFPSDIVREYLKGRKTLFIENNYMGQLALITRMFAGVEPTAVA
IKFNGRPITTDDVVAAYRRFETGENVIKIESDL
Download sequence
Identical sequences A4WH87
340102.Pars_0139 gi|145590404|ref|YP_001152406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]