SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_0841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_0841
Domain Number 1 Region: 20-172
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.98e-21
Family Clp protease, ClpP subunit 0.07
Further Details:      
 
Domain Number 2 Region: 322-391
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000628
Family NfeD domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_0841
Sequence length 394
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MAGWRAVVLALLASALALAASNAVALYLDGTIDGTAVTLARAALADAQSRGLPLVVVINT
YGGFLAPMDQIVELFLNAGVPVYAYVPEGGKAVSAGAFVAMAARRIYMAPTAEIGAAEPR
PPDPKVVNYAAARMRALASAKWNDSRVDIAESFVRENKVLTGAEAVKLGIAEPLPSGGWV
FVAEYRRDPLSSLLNALSDPAVISLLLLLGVVFIGYELLAGGFQGVGVVGGLLLVLALYL
LGQLGSEWLWAALAIGGATLIAAEIFAGHGAFAATGLALFGLSLYFASVSQPYYQLQGAS
YALSSLAALGALAVAYLGYKVRQAMRRKPLNYKAQLVGALGVAKTEIRPGQPGVAYVAEE
EWTAVSDEEIKPGERVVVEGVEGLTLMVKKAKSA
Download sequence
Identical sequences A4WJ60
gi|145591077|ref|YP_001153079.1| 340102.Pars_0841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]