SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_0918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_0918
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00000549
Family HEPN domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_0918
Sequence length 117
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MHFKWLERHVRHFQEALRGLERGDGYWTCYNAYISVRALLMGVLGFDPYKDVTTVATLTA
LVKKALPNAPGDVIDCAKCLEKRLSEPLGDRCVKCADKIVEYIKTLPLSPATKIADL
Download sequence
Identical sequences A4WJD2
gi|145591149|ref|YP_001153151.1| 340102.Pars_0918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]