SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_1250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_1250
Domain Number 1 Region: 181-438
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.31e-67
Family PFOR Pyr module 0.042
Further Details:      
 
Domain Number 2 Region: 11-205
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.89e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 
Domain Number 3 Region: 452-544
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000089
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_1250
Sequence length 546
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MKIDSLNVELTIRISGAQGEGVETTGRTLATVFAKLGYHVFAYRQYGSIIKGNPAMFYQI
RISDRKIYSHGRWRTYDVLIALNDTALVQHRGGAKYVVSEKEIPLTDIATKHGNRIMKNT
AALGALAALINLNPKYIAEQLTKEFGEGKVAEANIAVLDDAWRAAQAKYSPIADVERVGE
PRLLMSGAEALAVGAVMAGMKFYAAYPMTPASPMLHWLAQWGPKLGVAVVQPEDEIAAIN
MAIGAAYAGVRAATGTSGGGFDLMHEAFGLAAMIETPVVVFLAQRGGPSTGLPTETEQSD
LLMALSPAHGEYPHTVIAPRHIEEGLYAAAKAFNIAEKYQVPVIVLTDLYFNESLNTVEF
DPGRFRIERGELLNAPILWEEYKRYKITENGISPRAIPGTPGGMHIATSDEHDEKGDVIT
DTHKPEIRKAMHRKRMVKLEKIAEEMDPPDLRGGGEVVAVAWGSTSMPLMDIGGNGVGLA
LFRDIYPLPDGGWKAALNGAKEVVVVEVNYRGQFADYLASKGVKVSRKVLKWWGEPFSID
ELAEWL
Download sequence
Identical sequences A4WK97
gi|145591464|ref|YP_001153466.1| 340102.Pars_1250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]