SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340177.Cag_0347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340177.Cag_0347
Domain Number 1 Region: 139-435
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.83e-123
Family Enolase 0.0000000125
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.21e-57
Family Enolase N-terminal domain-like 0.00000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340177.Cag_0347
Sequence length 437
Comment (Chlorobium chlorochromatii CaD3)
Sequence
MPIISKVVARQILDSRGNPTVEVDVYTESSFGRAAVPSGASTGVHEAVELRDGDASVYLG
KGVLKAVENVNTVISDALEGMLVTEQEEIDEMLLALDGTPNKSNLGANALLGVSLACARA
GAEYTGLPLYRYIGGTMANTLPVPMMNVLNGGAHADNTVDFQEFMIMPAGFTSFSDALRA
GAEIFHSLKALLKSKGLSTAVGDEGGFAPNLRSNEEAIELVIEAIGKAGYKVGSPTDKGG
LGDAQVMIALDPASSEFYDAAKKRYVFKKSSKQELTSTEMAEYWERWVNTYPIISIEDGM
AEDDWEGWKLLTDKVGSRVQLVGDDLFVTNSIRLADGINRKVANSILIKVNQIGTLTETL
QAINLARLNGYTSVISHRSGETEDSTIAQIAVATNAGQIKTGSMSRSDRMAKYNELLRIE
EELGSQARYPGKAAFRV
Download sequence
Identical sequences Q3ATQ5
340177.Cag_0347 gi|78188325|ref|YP_378663.1| WP_011361393.1.38767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]