SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342108.amb1660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342108.amb1660
Domain Number 1 Region: 142-318
Classification Level Classification E-value
Superfamily E set domains 3.03e-55
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000911
Further Details:      
 
Domain Number 2 Region: 53-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.9e-21
Family Voltage-gated potassium channels 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 342108.amb1660
Sequence length 320
Comment (Magnetospirillum magneticum AMB-1)
Sequence
MPRVIPTPPSKARTSRSSTFVSVSGMTEGMKPPVSRPRILNPDGSSNIARLGLEKRGWLD
DHYHHLLTVSWPGFFAVIAGLYLMANALFALAYLACGDVIENARPGSFTDAFFFSVQTMA
TIGYGKLIPIGPLANTQVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSCTVVTEFEG
KPTLMMRLANLRVEQIIEADVHLVLVRSEISQEGMLFRRFHDLQLTRSHSPIFSLSWTIM
HPIDHHSPLYGETAETLRHSHSELLVLFTGHHEAFAQDVHARHAYSCDEIIWGGRFVDVF
TTLPDGRRALDLTKFHEIAQ
Download sequence
Identical sequences Q2W6R1
342108.amb1660 gi|83310759|ref|YP_421023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]