SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342108.amb3519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342108.amb3519
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.24e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 342108.amb3519
Sequence length 109
Comment (Magnetospirillum magneticum AMB-1)
Sequence
MEIREEQAGDATVLVPLARVDSSTAKAFEARVLAVVNAGAPKILIDFGELDYISSAGLRV
VLVGAKMTRGTRKFALCSMKPHIREVFDVSGFAKILSIYADRTAALAAL
Download sequence
Identical sequences Q2W1F2
WP_011385878.1.61852 gi|83312618|ref|YP_422882.1| 342108.amb3519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]