SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342109.XOO_1696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  342109.XOO_1696
Domain Number - Region: 86-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.017
Family NfeD domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 342109.XOO_1696
Sequence length 192
Comment (Xanthomonas oryzae MAFF 311018)
Sequence
MRWDVAVWAVLALLLIAAETLVPGAFLLWMGIAAAVVCVLVLVLPDIALLVQIVVFVVLS
FVSVQVYRTWCRGKGRESDRPLLNRRAEQVIGRRVLLDQAIDDGRGRVKVDDAFWVVAGP
DLPAGTPVRIVGVDGRPCWCSRSADVRGQGTCCAANVRIVAARRSIALRHCSPISVIALL
RARRSPGAAGRG
Download sequence
Identical sequences gi|84623353|ref|YP_450725.1| 342109.XOO_1696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]