SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342109.XOO_2769 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342109.XOO_2769
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-71
Family D-glucarate dehydratase-like 0.00016
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.88e-32
Family Enolase N-terminal domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 342109.XOO_2769
Sequence length 382
Comment (Xanthomonas oryzae MAFF 311018)
Sequence
MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
NDLWQTMYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
GGDRPGAIIQQITDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIREAFGNTIDF
GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTSIPLAAGERMFSR
FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAIAEAYDVGFAPHCPLGPIALAACLHVD
FVSHNAVLQEQSIGIHYNEGADLLDYVINKDDFHCVDGSIAALPKPGLGVEIDEDMLKRA
NENPPDWRNPVWRHSDGSIAEW
Download sequence
Identical sequences A0A0U4W082 B2SV55 Q2P1Q3
gi|188575952|ref|YP_001912881.1| WP_011408875.1.100287 WP_011408875.1.101918 WP_011408875.1.10801 WP_011408875.1.11746 WP_011408875.1.11992 WP_011408875.1.12016 WP_011408875.1.12038 WP_011408875.1.12284 WP_011408875.1.12532 WP_011408875.1.13943 WP_011408875.1.15093 WP_011408875.1.15664 WP_011408875.1.16001 WP_011408875.1.17939 WP_011408875.1.19029 WP_011408875.1.19407 WP_011408875.1.19779 WP_011408875.1.20356 WP_011408875.1.22155 WP_011408875.1.22948 WP_011408875.1.2575 WP_011408875.1.27990 WP_011408875.1.28412 WP_011408875.1.29999 WP_011408875.1.30088 WP_011408875.1.3010 WP_011408875.1.32656 WP_011408875.1.34187 WP_011408875.1.34656 WP_011408875.1.34831 WP_011408875.1.353 WP_011408875.1.35359 WP_011408875.1.38499 WP_011408875.1.39578 WP_011408875.1.40044 WP_011408875.1.40785 WP_011408875.1.41276 WP_011408875.1.42687 WP_011408875.1.42954 WP_011408875.1.43671 WP_011408875.1.44430 WP_011408875.1.45003 WP_011408875.1.4539 WP_011408875.1.46170 WP_011408875.1.47084 WP_011408875.1.47137 WP_011408875.1.48014 WP_011408875.1.48578 WP_011408875.1.49044 WP_011408875.1.49225 WP_011408875.1.49377 WP_011408875.1.50457 WP_011408875.1.50569 WP_011408875.1.51059 WP_011408875.1.52109 WP_011408875.1.53330 WP_011408875.1.537 WP_011408875.1.55471 WP_011408875.1.56638 WP_011408875.1.56661 WP_011408875.1.56997 WP_011408875.1.57225 WP_011408875.1.57350 WP_011408875.1.57652 WP_011408875.1.57864 WP_011408875.1.57935 WP_011408875.1.58736 WP_011408875.1.60363 WP_011408875.1.60953 WP_011408875.1.61025 WP_011408875.1.61774 WP_011408875.1.61876 WP_011408875.1.63306 WP_011408875.1.65775 WP_011408875.1.67359 WP_011408875.1.67821 WP_011408875.1.68588 WP_011408875.1.68727 WP_011408875.1.68760 WP_011408875.1.69729 WP_011408875.1.71791 WP_011408875.1.73657 WP_011408875.1.74787 WP_011408875.1.75518 WP_011408875.1.76491 WP_011408875.1.76573 WP_011408875.1.76801 WP_011408875.1.8070 WP_011408875.1.81518 WP_011408875.1.8269 WP_011408875.1.82912 WP_011408875.1.83077 WP_011408875.1.8313 WP_011408875.1.83277 WP_011408875.1.84104 WP_011408875.1.85262 WP_011408875.1.85266 WP_011408875.1.86486 WP_011408875.1.87020 WP_011408875.1.87238 WP_011408875.1.88561 WP_011408875.1.89095 WP_011408875.1.91866 WP_011408875.1.91997 WP_011408875.1.93038 WP_011408875.1.94099 WP_011408875.1.94601 WP_011408875.1.95101 WP_011408875.1.95975 WP_011408875.1.96729 WP_011408875.1.97155 WP_011408875.1.97395 WP_011408875.1.99258 gi|84624426|ref|YP_451798.1| 342109.XOO_2769 360094.PXO_00121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]