SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342109.XOO_3426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342109.XOO_3426
Domain Number 1 Region: 82-182
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 2.75e-26
Family PaaD-like 0.00043
Further Details:      
 
Weak hits

Sequence:  342109.XOO_3426
Domain Number - Region: 27-59
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0562
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 342109.XOO_3426
Sequence length 184
Comment (Xanthomonas oryzae MAFF 311018)
Sequence
MYSRSSEPVQFERDCDAVMVPQGDSVTLPAGSYGYITQALGGSYTVFVEGNLFRIAGKDG
DAIGKEAPPGLELPANASDEEVEALVWQQLRTCFDPEIPFNIVDLGLVYEAVVSHREEDN
QRRVDVKMTLTAPGCGMGEILVDDVRSKVEMIPTIAEADVELVFDPPWGRHMMSEAARLE
TGML
Download sequence
Identical sequences A0A0C5V3V6 A0A0M1KUB1 A0A0M1ML26 A0A0Q5J5X1 A0A0U4G9J4
291331.XOO3625 342109.XOO_3426 WP_011260066.1.100287 WP_011260066.1.101918 WP_011260066.1.10801 WP_011260066.1.11746 WP_011260066.1.11992 WP_011260066.1.12016 WP_011260066.1.12038 WP_011260066.1.12284 WP_011260066.1.12388 WP_011260066.1.12532 WP_011260066.1.13943 WP_011260066.1.15093 WP_011260066.1.15664 WP_011260066.1.16001 WP_011260066.1.1619 WP_011260066.1.17939 WP_011260066.1.19029 WP_011260066.1.19407 WP_011260066.1.19779 WP_011260066.1.20356 WP_011260066.1.21110 WP_011260066.1.21407 WP_011260066.1.22155 WP_011260066.1.22948 WP_011260066.1.2575 WP_011260066.1.27990 WP_011260066.1.28412 WP_011260066.1.29999 WP_011260066.1.30088 WP_011260066.1.3010 WP_011260066.1.32051 WP_011260066.1.32656 WP_011260066.1.34187 WP_011260066.1.34220 WP_011260066.1.34656 WP_011260066.1.34831 WP_011260066.1.35030 WP_011260066.1.353 WP_011260066.1.35359 WP_011260066.1.38499 WP_011260066.1.39578 WP_011260066.1.40044 WP_011260066.1.40545 WP_011260066.1.40784 WP_011260066.1.40785 WP_011260066.1.41276 WP_011260066.1.42687 WP_011260066.1.42954 WP_011260066.1.43671 WP_011260066.1.44430 WP_011260066.1.45003 WP_011260066.1.4539 WP_011260066.1.46170 WP_011260066.1.47084 WP_011260066.1.47137 WP_011260066.1.48014 WP_011260066.1.48578 WP_011260066.1.49044 WP_011260066.1.49225 WP_011260066.1.49305 WP_011260066.1.49377 WP_011260066.1.50457 WP_011260066.1.50569 WP_011260066.1.51059 WP_011260066.1.52109 WP_011260066.1.5326 WP_011260066.1.53330 WP_011260066.1.537 WP_011260066.1.54131 WP_011260066.1.55471 WP_011260066.1.56638 WP_011260066.1.56659 WP_011260066.1.56661 WP_011260066.1.56979 WP_011260066.1.56997 WP_011260066.1.57225 WP_011260066.1.57350 WP_011260066.1.57652 WP_011260066.1.57864 WP_011260066.1.57935 WP_011260066.1.58736 WP_011260066.1.60363 WP_011260066.1.60953 WP_011260066.1.61025 WP_011260066.1.61237 WP_011260066.1.61774 WP_011260066.1.61876 WP_011260066.1.63306 WP_011260066.1.65775 WP_011260066.1.67359 WP_011260066.1.67821 WP_011260066.1.68588 WP_011260066.1.68727 WP_011260066.1.68760 WP_011260066.1.69729 WP_011260066.1.70800 WP_011260066.1.71791 WP_011260066.1.73098 WP_011260066.1.73657 WP_011260066.1.74787 WP_011260066.1.75518 WP_011260066.1.76491 WP_011260066.1.76573 WP_011260066.1.76801 WP_011260066.1.80008 WP_011260066.1.8070 WP_011260066.1.81518 WP_011260066.1.8269 WP_011260066.1.82912 WP_011260066.1.83077 WP_011260066.1.8313 WP_011260066.1.83277 WP_011260066.1.84104 WP_011260066.1.85262 WP_011260066.1.85266 WP_011260066.1.86486 WP_011260066.1.87020 WP_011260066.1.87238 WP_011260066.1.88561 WP_011260066.1.89095 WP_011260066.1.89429 WP_011260066.1.89482 WP_011260066.1.90241 WP_011260066.1.91866 WP_011260066.1.91997 WP_011260066.1.92286 WP_011260066.1.93038 WP_011260066.1.93619 WP_011260066.1.94099 WP_011260066.1.94601 WP_011260066.1.95101 WP_011260066.1.95975 WP_011260066.1.96666 WP_011260066.1.96729 WP_011260066.1.97155 WP_011260066.1.97395 WP_011260066.1.99258 gi|84625083|ref|YP_452455.1| gi|122879279|ref|YP_202264.6|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]