SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342109.XOO_4164 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342109.XOO_4164
Domain Number 1 Region: 115-401
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.12e-71
Family D-glucarate dehydratase-like 0.00023
Further Details:      
 
Domain Number 2 Region: 26-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.38e-31
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 342109.XOO_4164
Sequence length 419
Comment (Xanthomonas oryzae MAFF 311018)
Sequence
MSQTSDSPAPLQGSARDREIVEARVIVTCPGRNFVTLKIRTRSGITGVGDATLNGRELAV
AAYLQEHLVPNLIGRDAGRIEDIWQFFYRGAYWRRGPVTMSAIAAVDVALWDILGKMAGM
PLYQLLGGRSREGALVYGHANGRDIAETTDEVGRFREMGFIAIRAQCGVPGIKKTYGISV
GGKPYEPAESELPTETVWSTPRYLGVVPKLFEQLRSDHGDEIELLHDAHHRLTPIEAARL
GRDLEPYRLFWLEDATPAENQRAFEIIRQHTVTPLAVGEVFNSIWDCKHLIEQQLIDYIR
TTIVHAGGITHVRRLADFAALHQVRTGFHGATDLSPVCMGAALHFDTWVPNFGIQEYMFH
SDEANAVFTHDYMFRDGRLHCGETPGHGVDIDETLAAKYPYVPKQLPIARLEDGAMCDW
Download sequence
Identical sequences A0A0U4UKU5
342109.XOO_4164 gi|84625821|ref|YP_453193.1| WP_011409724.1.100287 WP_011409724.1.12038 WP_011409724.1.12284 WP_011409724.1.12532 WP_011409724.1.15093 WP_011409724.1.17939 WP_011409724.1.20356 WP_011409724.1.22155 WP_011409724.1.22948 WP_011409724.1.2575 WP_011409724.1.28412 WP_011409724.1.30088 WP_011409724.1.353 WP_011409724.1.39578 WP_011409724.1.40785 WP_011409724.1.41276 WP_011409724.1.46170 WP_011409724.1.47084 WP_011409724.1.47137 WP_011409724.1.48014 WP_011409724.1.49377 WP_011409724.1.50457 WP_011409724.1.53330 WP_011409724.1.56997 WP_011409724.1.57652 WP_011409724.1.57864 WP_011409724.1.57935 WP_011409724.1.60363 WP_011409724.1.61025 WP_011409724.1.63306 WP_011409724.1.69729 WP_011409724.1.71791 WP_011409724.1.73657 WP_011409724.1.76573 WP_011409724.1.8070 WP_011409724.1.8269 WP_011409724.1.82912 WP_011409724.1.83277 WP_011409724.1.84104 WP_011409724.1.86486 WP_011409724.1.87238 WP_011409724.1.93038 WP_011409724.1.94099 WP_011409724.1.95975 WP_011409724.1.96729 WP_011409724.1.97155 WP_011409724.1.97395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]