SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342451.SSP1182 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  342451.SSP1182
Domain Number - Region: 173-234
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000102
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 342451.SSP1182
Sequence length 236
Comment (Staphylococcus saprophyticus)
Sequence
MILSSSLHTIFPSNLVEDGNWIDNIANFIVHPIGALILTCIIFLGFLYQLYSNKINVVGI
ISTIALLIFFLGFFVKGDVNFYSVILFGVGVILVIIELFVVGAVIGIIGMGFIIFSIITL
GDNLIFMIANVVFALILSIIEWVILVKGFKRKIPFLDKVVLKDSTNAEAGYTSHEDRSHL
VGKTATTSTDLRPAGIITLNNERIDAVSDGSFILRNKQVTILEVEGTRVVVREIES
Download sequence
Identical sequences A0A0G7GQH2 A0A1N6CKM3 A0A2K3Y3S0 A0A2K4C532 Q49Y17
342451.SSP1182 gi|73662491|ref|YP_301272.1| WP_011302996.1.10325 WP_011302996.1.15726 WP_011302996.1.18345 WP_011302996.1.18592 WP_011302996.1.25302 WP_011302996.1.26712 WP_011302996.1.27163 WP_011302996.1.28029 WP_011302996.1.28454 WP_011302996.1.31168 WP_011302996.1.37492 WP_011302996.1.37647 WP_011302996.1.43091 WP_011302996.1.43215 WP_011302996.1.45004 WP_011302996.1.59350 WP_011302996.1.66168 WP_011302996.1.68345 WP_011302996.1.68604 WP_011302996.1.74667 WP_011302996.1.76174 WP_011302996.1.77974 WP_011302996.1.80224 WP_011302996.1.8052 WP_011302996.1.81985 WP_011302996.1.82244 WP_011302996.1.84863 WP_011302996.1.9070 WP_011302996.1.91454 WP_011302996.1.94572 WP_011302996.1.99191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]