SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342610.Patl_0197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  342610.Patl_0197
Domain Number - Region: 108-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00968
Family NfeD domain-like 0.0099
Further Details:      
 
Domain Number - Region: 22-103
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.0497
Family Cation efflux protein transmembrane domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 342610.Patl_0197
Sequence length 151
Comment (Pseudoalteromonas atlantica T6c)
Sequence
MMWLSDNLGIGLISLGLLLLAIEILVLGFSTFVLFFVGCAAVITGILIQFGIVADTALNA
TLFVSLITAVLAVFLWKPLKNMQKDVDPKKASNDLIGHSFILATDTSAEQPAIYHFSGID
WRLVSEHPITSGTKVEVIAVDVGQFTIAPCA
Download sequence
Identical sequences Q15ZF9
342610.Patl_0197 gi|109896528|ref|YP_659783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]