SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 342610.Patl_3126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342610.Patl_3126
Domain Number 1 Region: 265-354
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000018
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 40-139
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000000053
Family D-glucarate dehydratase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 342610.Patl_3126
Sequence length 372
Comment (Pseudoalteromonas atlantica T6c)
Sequence
MFAESPIKRRESTRINVGSVPIGGGAPIAVQSMTNTLTTDVEATVAQIKRIVAVGGEIVR
VSVPTMDAAEAFKLIKQQVNVPLIADIHFDYRIALKVAEYGVDCLRINPGNIGSMERVRS
VVDCARDKGIPIRIGVNGGSLEKDLQEKYGEPTPDALVESAMRHVDILDKLNFDQFKVSV
KASDVFLAVGAYRELAKKIDQPLHLGITEAGGFRAGAVKSAVGLGMLLAEGIGDTIRISL
AADPVEEIKVGFDILKSLRIRSRGINFIACPSCSRQEFDVISTVNALETRLEDLLTPMDV
SIIGCVVNGPGEAEVSDLGLTGARNMSGYYVDGKRQKERLSNDDLVDQLEKRIRAKAALL
DSSKKIDIKHLG
Download sequence
Identical sequences Q15R56
342610.Patl_3126 gi|109899431|ref|YP_662686.1| WP_011575870.1.28837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]