SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 343509.SG0513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  343509.SG0513
Domain Number 1 Region: 143-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.22e-125
Family Enolase 0.000000000634
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.41e-54
Family Enolase N-terminal domain-like 0.000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 343509.SG0513
Sequence length 433
Comment (Sodalis glossinidius morsitans)
Sequence
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVDAVNGPIAQALTCKDAKDQAALDKTMIDLDGTENKSKFGANAILAVSLAAAK
AASASKGMPLYEHIAELNGTAGKFSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAKSIK
EAVRMGSEVFHNLAKVLKSKGMNTAVGDEGGYAPNLESNAAALAAIKEAVEKAGYMLGKD
ITLAMDCAASEFFGEATGNYNLKGEGKTFTSQEFTHYLEDLTKQYPIVSIEDGLNESDWD
GFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMA
KDAGYTTIISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGDR
APFNGLREVKGQA
Download sequence
Identical sequences A0A193QGC7 Q2NVN7
gi|85058491|ref|YP_454193.1| 343509.SG0513 WP_011410486.1.28452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]