SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 344609.SbBS512_E0423 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  344609.SbBS512_E0423
Domain Number - Region: 95-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000103
Family NfeD domain-like 0.0076
Further Details:      
 
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000458
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 344609.SbBS512_E0423
Sequence length 152
Comment (Shigella boydii CDC 3083 94)
Sequence
MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF
AILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLHIRAISS
Download sequence
Identical sequences B2U4U4
344609.SbBS512_E0423 gi|187730444|ref|YP_001879200.1| WP_000970322.1.14129 WP_000970322.1.19129 WP_000970322.1.28536 WP_000970322.1.3598 WP_000970322.1.37967 WP_000970322.1.41271 WP_000970322.1.49104 WP_000970322.1.51307 WP_000970322.1.54585 WP_000970322.1.57851 WP_000970322.1.60453 WP_000970322.1.62266 WP_000970322.1.68731 WP_000970322.1.71149 WP_000970322.1.79464 WP_000970322.1.79922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]