SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 345073.VC0395_A0496 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  345073.VC0395_A0496
Domain Number 1 Region: 92-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000615
Family NfeD domain-like 0.0039
Further Details:      
 
Weak hits

Sequence:  345073.VC0395_A0496
Domain Number - Region: 28-78
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00111
Family LacY-like proton/sugar symporter 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 345073.VC0395_A0496
Sequence length 149
Comment (Vibrio cholerae O395)
Sequence
MVELLSQLNFWHWLALGLLLLAAELLGTAGYFLWLGLSALLVGVLLAVMPLGWQLQWLAF
ASFSLVTTWLWWRRQFSRDKKQDTERDLNQKEKQLLGRIIPITQDTPAGEFQVTLGDTAW
TARCDQQLAAGSRVSVVAVDGIILVVQPI
Download sequence
Identical sequences A0A0H3AKR3 A0A0H6GC17 A0A0K9US43
gi|379740805|ref|YP_005332774.1| NP_230622.2.72393 WP_000229931.1.100264 WP_000229931.1.100388 WP_000229931.1.100440 WP_000229931.1.10071 WP_000229931.1.100976 WP_000229931.1.101051 WP_000229931.1.101117 WP_000229931.1.10121 WP_000229931.1.101220 WP_000229931.1.101314 WP_000229931.1.101507 WP_000229931.1.101677 WP_000229931.1.101933 WP_000229931.1.102054 WP_000229931.1.1024 WP_000229931.1.10626 WP_000229931.1.10834 WP_000229931.1.10887 WP_000229931.1.11270 WP_000229931.1.11351 WP_000229931.1.11879 WP_000229931.1.11885 WP_000229931.1.11965 WP_000229931.1.12252 WP_000229931.1.12262 WP_000229931.1.12332 WP_000229931.1.12525 WP_000229931.1.12527 WP_000229931.1.12548 WP_000229931.1.12590 WP_000229931.1.12686 WP_000229931.1.12902 WP_000229931.1.13053 WP_000229931.1.13155 WP_000229931.1.13156 WP_000229931.1.13454 WP_000229931.1.13652 WP_000229931.1.13725 WP_000229931.1.14080 WP_000229931.1.14179 WP_000229931.1.14263 WP_000229931.1.14904 WP_000229931.1.14995 WP_000229931.1.15109 WP_000229931.1.15134 WP_000229931.1.15179 WP_000229931.1.15200 WP_000229931.1.15516 WP_000229931.1.15786 WP_000229931.1.15997 WP_000229931.1.16351 WP_000229931.1.16382 WP_000229931.1.17232 WP_000229931.1.17295 WP_000229931.1.17621 WP_000229931.1.17738 WP_000229931.1.18375 WP_000229931.1.18392 WP_000229931.1.18447 WP_000229931.1.18577 WP_000229931.1.18845 WP_000229931.1.18862 WP_000229931.1.18916 WP_000229931.1.19126 WP_000229931.1.19128 WP_000229931.1.19442 WP_000229931.1.19503 WP_000229931.1.19597 WP_000229931.1.20107 WP_000229931.1.20379 WP_000229931.1.20404 WP_000229931.1.20602 WP_000229931.1.20669 WP_000229931.1.20699 WP_000229931.1.20758 WP_000229931.1.21073 WP_000229931.1.21281 WP_000229931.1.21558 WP_000229931.1.21671 WP_000229931.1.21717 WP_000229931.1.21764 WP_000229931.1.21815 WP_000229931.1.21866 WP_000229931.1.22521 WP_000229931.1.22773 WP_000229931.1.229 WP_000229931.1.22953 WP_000229931.1.2304 WP_000229931.1.2316 WP_000229931.1.23333 WP_000229931.1.2341 WP_000229931.1.23416 WP_000229931.1.23424 WP_000229931.1.23538 WP_000229931.1.2354 WP_000229931.1.23808 WP_000229931.1.23955 WP_000229931.1.240 WP_000229931.1.2401 WP_000229931.1.24106 WP_000229931.1.24280 WP_000229931.1.24345 WP_000229931.1.24399 WP_000229931.1.24980 WP_000229931.1.25386 WP_000229931.1.25649 WP_000229931.1.26020 WP_000229931.1.26156 WP_000229931.1.26223 WP_000229931.1.2627 WP_000229931.1.26326 WP_000229931.1.26508 WP_000229931.1.26580 WP_000229931.1.26813 WP_000229931.1.27186 WP_000229931.1.27435 WP_000229931.1.27458 WP_000229931.1.27639 WP_000229931.1.27863 WP_000229931.1.28431 WP_000229931.1.2849 WP_000229931.1.28508 WP_000229931.1.29095 WP_000229931.1.29535 WP_000229931.1.29708 WP_000229931.1.29889 WP_000229931.1.30107 WP_000229931.1.30292 WP_000229931.1.3032 WP_000229931.1.30360 WP_000229931.1.3054 WP_000229931.1.30927 WP_000229931.1.31096 WP_000229931.1.31718 WP_000229931.1.31853 WP_000229931.1.32264 WP_000229931.1.32271 WP_000229931.1.32814 WP_000229931.1.32955 WP_000229931.1.33019 WP_000229931.1.33093 WP_000229931.1.33625 WP_000229931.1.33811 WP_000229931.1.33819 WP_000229931.1.34108 WP_000229931.1.34195 WP_000229931.1.34261 WP_000229931.1.34634 WP_000229931.1.34643 WP_000229931.1.34663 WP_000229931.1.3514 WP_000229931.1.35201 WP_000229931.1.35266 WP_000229931.1.35630 WP_000229931.1.35880 WP_000229931.1.35881 WP_000229931.1.36322 WP_000229931.1.3635 WP_000229931.1.36354 WP_000229931.1.36441 WP_000229931.1.36513 WP_000229931.1.36668 WP_000229931.1.36686 WP_000229931.1.36874 WP_000229931.1.36973 WP_000229931.1.37054 WP_000229931.1.37260 WP_000229931.1.37262 WP_000229931.1.37537 WP_000229931.1.37676 WP_000229931.1.37999 WP_000229931.1.38420 WP_000229931.1.38590 WP_000229931.1.39208 WP_000229931.1.39514 WP_000229931.1.39675 WP_000229931.1.39853 WP_000229931.1.39933 WP_000229931.1.40039 WP_000229931.1.40152 WP_000229931.1.40433 WP_000229931.1.40459 WP_000229931.1.40470 WP_000229931.1.40491 WP_000229931.1.40542 WP_000229931.1.40571 WP_000229931.1.40740 WP_000229931.1.40782 WP_000229931.1.41284 WP_000229931.1.41538 WP_000229931.1.41569 WP_000229931.1.41573 WP_000229931.1.4175 WP_000229931.1.42128 WP_000229931.1.42152 WP_000229931.1.42498 WP_000229931.1.42617 WP_000229931.1.4272 WP_000229931.1.42783 WP_000229931.1.4284 WP_000229931.1.42853 WP_000229931.1.42885 WP_000229931.1.43103 WP_000229931.1.43335 WP_000229931.1.4365 WP_000229931.1.43884 WP_000229931.1.439 WP_000229931.1.44569 WP_000229931.1.44709 WP_000229931.1.44730 WP_000229931.1.45055 WP_000229931.1.45127 WP_000229931.1.45155 WP_000229931.1.45206 WP_000229931.1.45264 WP_000229931.1.45372 WP_000229931.1.45704 WP_000229931.1.45842 WP_000229931.1.45903 WP_000229931.1.45958 WP_000229931.1.46118 WP_000229931.1.46146 WP_000229931.1.46486 WP_000229931.1.46540 WP_000229931.1.4661 WP_000229931.1.47202 WP_000229931.1.4730 WP_000229931.1.4731 WP_000229931.1.47417 WP_000229931.1.47428 WP_000229931.1.47736 WP_000229931.1.47794 WP_000229931.1.47796 WP_000229931.1.47846 WP_000229931.1.47942 WP_000229931.1.48128 WP_000229931.1.48289 WP_000229931.1.48715 WP_000229931.1.48742 WP_000229931.1.488 WP_000229931.1.48927 WP_000229931.1.49238 WP_000229931.1.49317 WP_000229931.1.50254 WP_000229931.1.50277 WP_000229931.1.50577 WP_000229931.1.50625 WP_000229931.1.50813 WP_000229931.1.50822 WP_000229931.1.50899 WP_000229931.1.50980 WP_000229931.1.51160 WP_000229931.1.51177 WP_000229931.1.51661 WP_000229931.1.5201 WP_000229931.1.52391 WP_000229931.1.52676 WP_000229931.1.5320 WP_000229931.1.53214 WP_000229931.1.5397 WP_000229931.1.54191 WP_000229931.1.5425 WP_000229931.1.54398 WP_000229931.1.5450 WP_000229931.1.54706 WP_000229931.1.54901 WP_000229931.1.55092 WP_000229931.1.55665 WP_000229931.1.55932 WP_000229931.1.56429 WP_000229931.1.56785 WP_000229931.1.56807 WP_000229931.1.57148 WP_000229931.1.57300 WP_000229931.1.57518 WP_000229931.1.57546 WP_000229931.1.57678 WP_000229931.1.57945 WP_000229931.1.58295 WP_000229931.1.58596 WP_000229931.1.58844 WP_000229931.1.58975 WP_000229931.1.59010 WP_000229931.1.59194 WP_000229931.1.59378 WP_000229931.1.59394 WP_000229931.1.5943 WP_000229931.1.59554 WP_000229931.1.59633 WP_000229931.1.59741 WP_000229931.1.59916 WP_000229931.1.60386 WP_000229931.1.60633 WP_000229931.1.60694 WP_000229931.1.60955 WP_000229931.1.61169 WP_000229931.1.61523 WP_000229931.1.61644 WP_000229931.1.61753 WP_000229931.1.61869 WP_000229931.1.61875 WP_000229931.1.61935 WP_000229931.1.62165 WP_000229931.1.62324 WP_000229931.1.62425 WP_000229931.1.63347 WP_000229931.1.63546 WP_000229931.1.6366 WP_000229931.1.63723 WP_000229931.1.63749 WP_000229931.1.63779 WP_000229931.1.63911 WP_000229931.1.64201 WP_000229931.1.64253 WP_000229931.1.64315 WP_000229931.1.64382 WP_000229931.1.64441 WP_000229931.1.65007 WP_000229931.1.65051 WP_000229931.1.65086 WP_000229931.1.65528 WP_000229931.1.66329 WP_000229931.1.66633 WP_000229931.1.66696 WP_000229931.1.67616 WP_000229931.1.67770 WP_000229931.1.68424 WP_000229931.1.68506 WP_000229931.1.68723 WP_000229931.1.68925 WP_000229931.1.69049 WP_000229931.1.69843 WP_000229931.1.69857 WP_000229931.1.70069 WP_000229931.1.70176 WP_000229931.1.70247 WP_000229931.1.7049 WP_000229931.1.70775 WP_000229931.1.70813 WP_000229931.1.70892 WP_000229931.1.71129 WP_000229931.1.72106 WP_000229931.1.72241 WP_000229931.1.72326 WP_000229931.1.72361 WP_000229931.1.72369 WP_000229931.1.7238 WP_000229931.1.72480 WP_000229931.1.72856 WP_000229931.1.72964 WP_000229931.1.73148 WP_000229931.1.73429 WP_000229931.1.73555 WP_000229931.1.73855 WP_000229931.1.73929 WP_000229931.1.74111 WP_000229931.1.74503 WP_000229931.1.74666 WP_000229931.1.74991 WP_000229931.1.75012 WP_000229931.1.75326 WP_000229931.1.75378 WP_000229931.1.75778 WP_000229931.1.76425 WP_000229931.1.76486 WP_000229931.1.7654 WP_000229931.1.76645 WP_000229931.1.77029 WP_000229931.1.7717 WP_000229931.1.77355 WP_000229931.1.77397 WP_000229931.1.77445 WP_000229931.1.77703 WP_000229931.1.77794 WP_000229931.1.77830 WP_000229931.1.77914 WP_000229931.1.78157 WP_000229931.1.78428 WP_000229931.1.78531 WP_000229931.1.79044 WP_000229931.1.79776 WP_000229931.1.79943 WP_000229931.1.80024 WP_000229931.1.8023 WP_000229931.1.80339 WP_000229931.1.80500 WP_000229931.1.80618 WP_000229931.1.80628 WP_000229931.1.80702 WP_000229931.1.80744 WP_000229931.1.80808 WP_000229931.1.8117 WP_000229931.1.81871 WP_000229931.1.81917 WP_000229931.1.82119 WP_000229931.1.82193 WP_000229931.1.82248 WP_000229931.1.82262 WP_000229931.1.82413 WP_000229931.1.82583 WP_000229931.1.83040 WP_000229931.1.83073 WP_000229931.1.83082 WP_000229931.1.83109 WP_000229931.1.83703 WP_000229931.1.83761 WP_000229931.1.84519 WP_000229931.1.84610 WP_000229931.1.8480 WP_000229931.1.85007 WP_000229931.1.85086 WP_000229931.1.85388 WP_000229931.1.85498 WP_000229931.1.85822 WP_000229931.1.85878 WP_000229931.1.85961 WP_000229931.1.85972 WP_000229931.1.85998 WP_000229931.1.86057 WP_000229931.1.86192 WP_000229931.1.86269 WP_000229931.1.86874 WP_000229931.1.86879 WP_000229931.1.87274 WP_000229931.1.87335 WP_000229931.1.87355 WP_000229931.1.87573 WP_000229931.1.87602 WP_000229931.1.87804 WP_000229931.1.88057 WP_000229931.1.88230 WP_000229931.1.88283 WP_000229931.1.88350 WP_000229931.1.88556 WP_000229931.1.8867 WP_000229931.1.89144 WP_000229931.1.89441 WP_000229931.1.89447 WP_000229931.1.89719 WP_000229931.1.89822 WP_000229931.1.89889 WP_000229931.1.8997 WP_000229931.1.89995 WP_000229931.1.90133 WP_000229931.1.90227 WP_000229931.1.90437 WP_000229931.1.90675 WP_000229931.1.90774 WP_000229931.1.90889 WP_000229931.1.91247 WP_000229931.1.91262 WP_000229931.1.91274 WP_000229931.1.91539 WP_000229931.1.91747 WP_000229931.1.91794 WP_000229931.1.91841 WP_000229931.1.92022 WP_000229931.1.92038 WP_000229931.1.92063 WP_000229931.1.92069 WP_000229931.1.92157 WP_000229931.1.92401 WP_000229931.1.92516 WP_000229931.1.92559 WP_000229931.1.92696 WP_000229931.1.92703 WP_000229931.1.92952 WP_000229931.1.92993 WP_000229931.1.9302 WP_000229931.1.93060 WP_000229931.1.93399 WP_000229931.1.93836 WP_000229931.1.93945 WP_000229931.1.94255 WP_000229931.1.94426 WP_000229931.1.94441 WP_000229931.1.94481 WP_000229931.1.94774 WP_000229931.1.95516 WP_000229931.1.95549 WP_000229931.1.9561 WP_000229931.1.95662 WP_000229931.1.95733 WP_000229931.1.95976 WP_000229931.1.96001 WP_000229931.1.9607 WP_000229931.1.96089 WP_000229931.1.96187 WP_000229931.1.96311 WP_000229931.1.96471 WP_000229931.1.9660 WP_000229931.1.96687 WP_000229931.1.96693 WP_000229931.1.96704 WP_000229931.1.96980 WP_000229931.1.97100 WP_000229931.1.97144 WP_000229931.1.97288 WP_000229931.1.97516 WP_000229931.1.97552 WP_000229931.1.97562 WP_000229931.1.97799 WP_000229931.1.97832 WP_000229931.1.9787 WP_000229931.1.98021 WP_000229931.1.98116 WP_000229931.1.98172 WP_000229931.1.98246 WP_000229931.1.98280 WP_000229931.1.98624 WP_000229931.1.98642 WP_000229931.1.99128 WP_000229931.1.99204 WP_000229931.1.99417 WP_000229931.1.99452 WP_000229931.1.995 WP_000229931.1.99872 WP_000229931.1.99949 WP_000229931.1.99992 gi|471237056|ref|NP_230622.2| gi|147674677|ref|YP_001216447.1| 345073.VC0395_A0496 gi|147674677|ref|YP_001216447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]