SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 345073.VC0395_A1923 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  345073.VC0395_A1923
Domain Number 1 Region: 465-553
Classification Level Classification E-value
Superfamily PilZ domain-like 0.000000902
Family PilZ domain 0.019
Further Details:      
 
Weak hits

Sequence:  345073.VC0395_A1923
Domain Number - Region: 141-199
Classification Level Classification E-value
Superfamily PilZ domain-like 0.000145
Family PilZ domain 0.019
Further Details:      
 
Domain Number - Region: 190-279
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00667
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 345073.VC0395_A1923
Sequence length 779
Comment (Vibrio cholerae O395)
Sequence
MQQTEILSLVERLIPVYRSGDLDYLLSQMTEGHPPSAKLLVKMELNRLMAPCTKSIDLRG
KVQGECREYHFDGRQHWLDDVAFNSYQKSLKKFGAYTEGVWEAVNNTRNNFRVMKQQGKL
DPKTDQPKDTSFEVEPVKLGYDLKRQENRLKISSQIEIHLKNEQLVHGLSVDLSPSGAKL
KVPAAFDYKLGEVIQVYFSDLNKTSNVVGLHKSIDYRILGVDESYDSDAIKFLRVLKLSD
TDVIEKVIEEAIQTNTQKARHDNQDKIIRARTRGYEHMYLKHTCNLPLFFSGNELKLALL
TENNRPIWQYWHDERNQQALGTLFKPERMAHLTAPGVRGSNNVLYAFKHEHQHKTLFFSM
LMPEATQEQRKLFWHIGAKRDSWKAFRLFVFELSDEERKTLAEHSRELADQSRSLTHCGV
LQEISDTEAAHDYLLVEKPNLPSSTLNDFRHPRQVVGTPMGIYFDARSRRKEPRYRFSTP
VQVSIDALKVTGATVDLSKRGLSLLLDTPLDVKANDQVWVDYLELKLYDKSLPLDKAPYK
VVRIGPEGRRLQLVIEENLQTLKTIAFFNSIIEHNQDKLLIKEEILPSNALLESLHNILL
DKMVSTPFFVEKVGSNLKPKVIGVNYPLPPHLALLAKLGSENRITLQPIFKGHTNSLLAT
PMKRIEGAVPQYHEVYLSAVKYGTRIQSVESRLLSDFADTRERIRFIRQGQAMGEFYALR
VSGVPVFAPITNLLRSDLTELAEISPHHAKSLEKEMLAQVGYGELVDITEEVLIRLELT
Download sequence
Identical sequences A0A0H3AIZ6 A0A2K0SB13
345073.VC0395_A1923 gi|147673923|ref|YP_001217847.1| WP_001187861.1.14179 WP_001187861.1.15134 WP_001187861.1.17738 WP_001187861.1.19428 WP_001187861.1.2316 WP_001187861.1.25649 WP_001187861.1.26223 WP_001187861.1.34643 WP_001187861.1.36322 WP_001187861.1.40782 WP_001187861.1.46540 WP_001187861.1.47794 WP_001187861.1.52676 WP_001187861.1.53085 WP_001187861.1.65528 WP_001187861.1.70775 WP_001187861.1.78428 WP_001187861.1.89719 gi|147673923|ref|YP_001217847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]