SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 345073.VC0395_A2025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  345073.VC0395_A2025
Domain Number 1 Region: 144-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.53e-128
Family Enolase 0.00000000119
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.36e-56
Family Enolase N-terminal domain-like 0.000000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 345073.VC0395_A2025
Sequence length 433
Comment (Vibrio cholerae O395)
Sequence
MSKIVKVLGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVLKALAAVNGPIADALVGKDAKDQATIDQIMIDLDGTENKSNFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTPGVFSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAKTLK
EAVRMGAEVFHNLAKVLKSKGYNTAVGDEGGFAPNLKSNAEALEVIAEAVAAAGYKLGTD
ITLAMDCAASEFYDAEKKEYNLKGEGRIFTSNGFSDFLEELTEKFPIVSIEDGLDESDWE
GFAYQTEKLGKKIQIVGDDLFVTNTKILKRGIDNGIANSILIKFNQIGSLTETLAAIKMA
KDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGSR
APFNGLKEVKGQA
Download sequence
Identical sequences A0A086SNR1 A0A0H3Q1P0 A0A0K9UTM6 A0A0X1KZI7 A0A1D8S8N1 A0A2J9UBR2 A5F5I3 C2HWB7 C3LQZ0 D2YRL9 Q9KPC5
gi|360036322|ref|YP_004938085.1| gi|227082568|ref|YP_002811119.1| gi|379742235|ref|YP_005334204.1| gi|229606998|ref|YP_002877646.1| gi|15642443|ref|NP_232076.1| 243277.VC2447 345073.VC0395_A2025 579112.VCM66_2370 593588.VCD_001907 gi|147675028|ref|YP_001217949.1| gi|147675028|ref|YP_001217949.1| NP_232076.1.72393 WP_000036741.1.100264 WP_000036741.1.100388 WP_000036741.1.100440 WP_000036741.1.100659 WP_000036741.1.10071 WP_000036741.1.100924 WP_000036741.1.100976 WP_000036741.1.101051 WP_000036741.1.101117 WP_000036741.1.10121 WP_000036741.1.101220 WP_000036741.1.101314 WP_000036741.1.101507 WP_000036741.1.101677 WP_000036741.1.101933 WP_000036741.1.102054 WP_000036741.1.1024 WP_000036741.1.10453 WP_000036741.1.10626 WP_000036741.1.10834 WP_000036741.1.10874 WP_000036741.1.10887 WP_000036741.1.11270 WP_000036741.1.11879 WP_000036741.1.11885 WP_000036741.1.11965 WP_000036741.1.11987 WP_000036741.1.1219 WP_000036741.1.12252 WP_000036741.1.12262 WP_000036741.1.12332 WP_000036741.1.12486 WP_000036741.1.12525 WP_000036741.1.12527 WP_000036741.1.12548 WP_000036741.1.12590 WP_000036741.1.12686 WP_000036741.1.12828 WP_000036741.1.12902 WP_000036741.1.13053 WP_000036741.1.13155 WP_000036741.1.13156 WP_000036741.1.13395 WP_000036741.1.13454 WP_000036741.1.13652 WP_000036741.1.13725 WP_000036741.1.14080 WP_000036741.1.14179 WP_000036741.1.14257 WP_000036741.1.14263 WP_000036741.1.14353 WP_000036741.1.14553 WP_000036741.1.14904 WP_000036741.1.14995 WP_000036741.1.15109 WP_000036741.1.15134 WP_000036741.1.15179 WP_000036741.1.15200 WP_000036741.1.15516 WP_000036741.1.15786 WP_000036741.1.15919 WP_000036741.1.15997 WP_000036741.1.16115 WP_000036741.1.16351 WP_000036741.1.16382 WP_000036741.1.17001 WP_000036741.1.17232 WP_000036741.1.17295 WP_000036741.1.17621 WP_000036741.1.17738 WP_000036741.1.18375 WP_000036741.1.18392 WP_000036741.1.18447 WP_000036741.1.18484 WP_000036741.1.18577 WP_000036741.1.18845 WP_000036741.1.18862 WP_000036741.1.18916 WP_000036741.1.19126 WP_000036741.1.19128 WP_000036741.1.19428 WP_000036741.1.19442 WP_000036741.1.19503 WP_000036741.1.19597 WP_000036741.1.19924 WP_000036741.1.20065 WP_000036741.1.20107 WP_000036741.1.20336 WP_000036741.1.20379 WP_000036741.1.20404 WP_000036741.1.20595 WP_000036741.1.20602 WP_000036741.1.20669 WP_000036741.1.20699 WP_000036741.1.20758 WP_000036741.1.21073 WP_000036741.1.21281 WP_000036741.1.21558 WP_000036741.1.21671 WP_000036741.1.21717 WP_000036741.1.21764 WP_000036741.1.21815 WP_000036741.1.21866 WP_000036741.1.22521 WP_000036741.1.2269 WP_000036741.1.22770 WP_000036741.1.22773 WP_000036741.1.229 WP_000036741.1.22953 WP_000036741.1.2304 WP_000036741.1.2316 WP_000036741.1.23312 WP_000036741.1.23333 WP_000036741.1.23361 WP_000036741.1.2341 WP_000036741.1.23416 WP_000036741.1.23424 WP_000036741.1.23532 WP_000036741.1.23538 WP_000036741.1.2354 WP_000036741.1.23637 WP_000036741.1.23751 WP_000036741.1.23761 WP_000036741.1.23808 WP_000036741.1.23955 WP_000036741.1.240 WP_000036741.1.2401 WP_000036741.1.24106 WP_000036741.1.24280 WP_000036741.1.24345 WP_000036741.1.24399 WP_000036741.1.2496 WP_000036741.1.24980 WP_000036741.1.25073 WP_000036741.1.25386 WP_000036741.1.25649 WP_000036741.1.26020 WP_000036741.1.26156 WP_000036741.1.26223 WP_000036741.1.2627 WP_000036741.1.26326 WP_000036741.1.26508 WP_000036741.1.26580 WP_000036741.1.27186 WP_000036741.1.27435 WP_000036741.1.27458 WP_000036741.1.27532 WP_000036741.1.27639 WP_000036741.1.27822 WP_000036741.1.27863 WP_000036741.1.28431 WP_000036741.1.2849 WP_000036741.1.28508 WP_000036741.1.29095 WP_000036741.1.29535 WP_000036741.1.29708 WP_000036741.1.29889 WP_000036741.1.30045 WP_000036741.1.30107 WP_000036741.1.30292 WP_000036741.1.3032 WP_000036741.1.30360 WP_000036741.1.3054 WP_000036741.1.30927 WP_000036741.1.31096 WP_000036741.1.31396 WP_000036741.1.31718 WP_000036741.1.31853 WP_000036741.1.31964 WP_000036741.1.32111 WP_000036741.1.32264 WP_000036741.1.32271 WP_000036741.1.32395 WP_000036741.1.32814 WP_000036741.1.32942 WP_000036741.1.32955 WP_000036741.1.33019 WP_000036741.1.33093 WP_000036741.1.33811 WP_000036741.1.33819 WP_000036741.1.34108 WP_000036741.1.34133 WP_000036741.1.34195 WP_000036741.1.34261 WP_000036741.1.34634 WP_000036741.1.34643 WP_000036741.1.34663 WP_000036741.1.3514 WP_000036741.1.35201 WP_000036741.1.35266 WP_000036741.1.35630 WP_000036741.1.35880 WP_000036741.1.35881 WP_000036741.1.36322 WP_000036741.1.3635 WP_000036741.1.36354 WP_000036741.1.36364 WP_000036741.1.36384 WP_000036741.1.36417 WP_000036741.1.36441 WP_000036741.1.36513 WP_000036741.1.36668 WP_000036741.1.36686 WP_000036741.1.36874 WP_000036741.1.36956 WP_000036741.1.36973 WP_000036741.1.37054 WP_000036741.1.37260 WP_000036741.1.37262 WP_000036741.1.37537 WP_000036741.1.37557 WP_000036741.1.37676 WP_000036741.1.37784 WP_000036741.1.37999 WP_000036741.1.38420 WP_000036741.1.38590 WP_000036741.1.39208 WP_000036741.1.39460 WP_000036741.1.39514 WP_000036741.1.39675 WP_000036741.1.39853 WP_000036741.1.39933 WP_000036741.1.40039 WP_000036741.1.40152 WP_000036741.1.40346 WP_000036741.1.40433 WP_000036741.1.40459 WP_000036741.1.40470 WP_000036741.1.40484 WP_000036741.1.40491 WP_000036741.1.40542 WP_000036741.1.40571 WP_000036741.1.40740 WP_000036741.1.40782 WP_000036741.1.41284 WP_000036741.1.41538 WP_000036741.1.41569 WP_000036741.1.41573 WP_000036741.1.4175 WP_000036741.1.42128 WP_000036741.1.42152 WP_000036741.1.42441 WP_000036741.1.42498 WP_000036741.1.42617 WP_000036741.1.4272 WP_000036741.1.42783 WP_000036741.1.4284 WP_000036741.1.42853 WP_000036741.1.42865 WP_000036741.1.43103 WP_000036741.1.43222 WP_000036741.1.43335 WP_000036741.1.43407 WP_000036741.1.43428 WP_000036741.1.4365 WP_000036741.1.43884 WP_000036741.1.439 WP_000036741.1.44136 WP_000036741.1.44555 WP_000036741.1.44569 WP_000036741.1.44709 WP_000036741.1.44730 WP_000036741.1.45055 WP_000036741.1.45127 WP_000036741.1.45155 WP_000036741.1.45206 WP_000036741.1.45264 WP_000036741.1.45372 WP_000036741.1.45704 WP_000036741.1.45842 WP_000036741.1.45903 WP_000036741.1.45958 WP_000036741.1.46118 WP_000036741.1.46146 WP_000036741.1.46486 WP_000036741.1.46540 WP_000036741.1.4661 WP_000036741.1.4701 WP_000036741.1.47202 WP_000036741.1.4730 WP_000036741.1.4731 WP_000036741.1.47417 WP_000036741.1.47428 WP_000036741.1.47736 WP_000036741.1.47794 WP_000036741.1.47796 WP_000036741.1.47846 WP_000036741.1.47942 WP_000036741.1.48128 WP_000036741.1.48289 WP_000036741.1.48305 WP_000036741.1.48659 WP_000036741.1.48715 WP_000036741.1.48742 WP_000036741.1.488 WP_000036741.1.48874 WP_000036741.1.48927 WP_000036741.1.48984 WP_000036741.1.49238 WP_000036741.1.49317 WP_000036741.1.49593 WP_000036741.1.50254 WP_000036741.1.50277 WP_000036741.1.5028 WP_000036741.1.50577 WP_000036741.1.50625 WP_000036741.1.50813 WP_000036741.1.50822 WP_000036741.1.50899 WP_000036741.1.50980 WP_000036741.1.51160 WP_000036741.1.51163 WP_000036741.1.51177 WP_000036741.1.51661 WP_000036741.1.5201 WP_000036741.1.52391 WP_000036741.1.52676 WP_000036741.1.53085 WP_000036741.1.5320 WP_000036741.1.53214 WP_000036741.1.53823 WP_000036741.1.54191 WP_000036741.1.5425 WP_000036741.1.54398 WP_000036741.1.5450 WP_000036741.1.54706 WP_000036741.1.54831 WP_000036741.1.54901 WP_000036741.1.55092 WP_000036741.1.55208 WP_000036741.1.55665 WP_000036741.1.55832 WP_000036741.1.55917 WP_000036741.1.55929 WP_000036741.1.55932 WP_000036741.1.56429 WP_000036741.1.56785 WP_000036741.1.56807 WP_000036741.1.57098 WP_000036741.1.57148 WP_000036741.1.57300 WP_000036741.1.57518 WP_000036741.1.57546 WP_000036741.1.57678 WP_000036741.1.57751 WP_000036741.1.57945 WP_000036741.1.58295 WP_000036741.1.58367 WP_000036741.1.58596 WP_000036741.1.58844 WP_000036741.1.58975 WP_000036741.1.59010 WP_000036741.1.59194 WP_000036741.1.59378 WP_000036741.1.59394 WP_000036741.1.5943 WP_000036741.1.59554 WP_000036741.1.59633 WP_000036741.1.59741 WP_000036741.1.59916 WP_000036741.1.60216 WP_000036741.1.60386 WP_000036741.1.60633 WP_000036741.1.60694 WP_000036741.1.60800 WP_000036741.1.60955 WP_000036741.1.61169 WP_000036741.1.61523 WP_000036741.1.61624 WP_000036741.1.61644 WP_000036741.1.61753 WP_000036741.1.61869 WP_000036741.1.61875 WP_000036741.1.61935 WP_000036741.1.62165 WP_000036741.1.62324 WP_000036741.1.62425 WP_000036741.1.62763 WP_000036741.1.63347 WP_000036741.1.63546 WP_000036741.1.63655 WP_000036741.1.6366 WP_000036741.1.63723 WP_000036741.1.63749 WP_000036741.1.63779 WP_000036741.1.63911 WP_000036741.1.64033 WP_000036741.1.64201 WP_000036741.1.64253 WP_000036741.1.64315 WP_000036741.1.64382 WP_000036741.1.64441 WP_000036741.1.6455 WP_000036741.1.65007 WP_000036741.1.65051 WP_000036741.1.65086 WP_000036741.1.65469 WP_000036741.1.65528 WP_000036741.1.66329 WP_000036741.1.66459 WP_000036741.1.66633 WP_000036741.1.66696 WP_000036741.1.67616 WP_000036741.1.6762 WP_000036741.1.67770 WP_000036741.1.67839 WP_000036741.1.68424 WP_000036741.1.68506 WP_000036741.1.68723 WP_000036741.1.68863 WP_000036741.1.68925 WP_000036741.1.69049 WP_000036741.1.69085 WP_000036741.1.69157 WP_000036741.1.69530 WP_000036741.1.69843 WP_000036741.1.69857 WP_000036741.1.69943 WP_000036741.1.70069 WP_000036741.1.70176 WP_000036741.1.70222 WP_000036741.1.70247 WP_000036741.1.7049 WP_000036741.1.70775 WP_000036741.1.70813 WP_000036741.1.70892 WP_000036741.1.71129 WP_000036741.1.72106 WP_000036741.1.72241 WP_000036741.1.72326 WP_000036741.1.72328 WP_000036741.1.72361 WP_000036741.1.72369 WP_000036741.1.7238 WP_000036741.1.72480 WP_000036741.1.72856 WP_000036741.1.72964 WP_000036741.1.73148 WP_000036741.1.73297 WP_000036741.1.73429 WP_000036741.1.73555 WP_000036741.1.73855 WP_000036741.1.73929 WP_000036741.1.74111 WP_000036741.1.74503 WP_000036741.1.74666 WP_000036741.1.75012 WP_000036741.1.75326 WP_000036741.1.75378 WP_000036741.1.75778 WP_000036741.1.75796 WP_000036741.1.76271 WP_000036741.1.76320 WP_000036741.1.76425 WP_000036741.1.76486 WP_000036741.1.7654 WP_000036741.1.76645 WP_000036741.1.77029 WP_000036741.1.7717 WP_000036741.1.77355 WP_000036741.1.77397 WP_000036741.1.77445 WP_000036741.1.77703 WP_000036741.1.77794 WP_000036741.1.77830 WP_000036741.1.77914 WP_000036741.1.78157 WP_000036741.1.78172 WP_000036741.1.78428 WP_000036741.1.78531 WP_000036741.1.78740 WP_000036741.1.79044 WP_000036741.1.79776 WP_000036741.1.79943 WP_000036741.1.80024 WP_000036741.1.8023 WP_000036741.1.80301 WP_000036741.1.80339 WP_000036741.1.80500 WP_000036741.1.80526 WP_000036741.1.80618 WP_000036741.1.80628 WP_000036741.1.80702 WP_000036741.1.80744 WP_000036741.1.80808 WP_000036741.1.80909 WP_000036741.1.8117 WP_000036741.1.81563 WP_000036741.1.81871 WP_000036741.1.81872 WP_000036741.1.81917 WP_000036741.1.82030 WP_000036741.1.82119 WP_000036741.1.82193 WP_000036741.1.82248 WP_000036741.1.82262 WP_000036741.1.82413 WP_000036741.1.82583 WP_000036741.1.83040 WP_000036741.1.83073 WP_000036741.1.83082 WP_000036741.1.83109 WP_000036741.1.83703 WP_000036741.1.83761 WP_000036741.1.84385 WP_000036741.1.84519 WP_000036741.1.84610 WP_000036741.1.8480 WP_000036741.1.85007 WP_000036741.1.85086 WP_000036741.1.85388 WP_000036741.1.85498 WP_000036741.1.85822 WP_000036741.1.85878 WP_000036741.1.85961 WP_000036741.1.85972 WP_000036741.1.85998 WP_000036741.1.86192 WP_000036741.1.86269 WP_000036741.1.86874 WP_000036741.1.86879 WP_000036741.1.87274 WP_000036741.1.87286 WP_000036741.1.87335 WP_000036741.1.87355 WP_000036741.1.87573 WP_000036741.1.87602 WP_000036741.1.87625 WP_000036741.1.87753 WP_000036741.1.87804 WP_000036741.1.88057 WP_000036741.1.88230 WP_000036741.1.88283 WP_000036741.1.88292 WP_000036741.1.88350 WP_000036741.1.88556 WP_000036741.1.8867 WP_000036741.1.89144 WP_000036741.1.89441 WP_000036741.1.89447 WP_000036741.1.89719 WP_000036741.1.89889 WP_000036741.1.8997 WP_000036741.1.89995 WP_000036741.1.90120 WP_000036741.1.90133 WP_000036741.1.90227 WP_000036741.1.9040 WP_000036741.1.90437 WP_000036741.1.90675 WP_000036741.1.90774 WP_000036741.1.90889 WP_000036741.1.91247 WP_000036741.1.91262 WP_000036741.1.91274 WP_000036741.1.91539 WP_000036741.1.91747 WP_000036741.1.91794 WP_000036741.1.91841 WP_000036741.1.92022 WP_000036741.1.92038 WP_000036741.1.92063 WP_000036741.1.92069 WP_000036741.1.92157 WP_000036741.1.92322 WP_000036741.1.92401 WP_000036741.1.92412 WP_000036741.1.92516 WP_000036741.1.92559 WP_000036741.1.92632 WP_000036741.1.92696 WP_000036741.1.92703 WP_000036741.1.92952 WP_000036741.1.92993 WP_000036741.1.9302 WP_000036741.1.93060 WP_000036741.1.93399 WP_000036741.1.93441 WP_000036741.1.93836 WP_000036741.1.93945 WP_000036741.1.94255 WP_000036741.1.94426 WP_000036741.1.94441 WP_000036741.1.94481 WP_000036741.1.94827 WP_000036741.1.94887 WP_000036741.1.95204 WP_000036741.1.95516 WP_000036741.1.95549 WP_000036741.1.9561 WP_000036741.1.95662 WP_000036741.1.95733 WP_000036741.1.95818 WP_000036741.1.96001 WP_000036741.1.9607 WP_000036741.1.96089 WP_000036741.1.96187 WP_000036741.1.96311 WP_000036741.1.96471 WP_000036741.1.9660 WP_000036741.1.96687 WP_000036741.1.96693 WP_000036741.1.96704 WP_000036741.1.96980 WP_000036741.1.97100 WP_000036741.1.97144 WP_000036741.1.97288 WP_000036741.1.97405 WP_000036741.1.97516 WP_000036741.1.97552 WP_000036741.1.97562 WP_000036741.1.97650 WP_000036741.1.97799 WP_000036741.1.97832 WP_000036741.1.9787 WP_000036741.1.98021 WP_000036741.1.98116 WP_000036741.1.98172 WP_000036741.1.98246 WP_000036741.1.98280 WP_000036741.1.98373 WP_000036741.1.98619 WP_000036741.1.98624 WP_000036741.1.98642 WP_000036741.1.99128 WP_000036741.1.99204 WP_000036741.1.9939 WP_000036741.1.99417 WP_000036741.1.99452 WP_000036741.1.995 WP_000036741.1.99861 WP_000036741.1.99872 WP_000036741.1.99949 WP_000036741.1.99992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]