SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 347255.RAF_ORF1225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347255.RAF_ORF1225
Domain Number 1 Region: 116-219
Classification Level Classification E-value
Superfamily Acid proteases 3.08e-19
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 347255.RAF_ORF1225
Sequence length 231
Comment (Rickettsia africae ESF 5)
Sequence
MNKKLIKLIFIICSTVIVTGLLYKYINQHYPKFFKAPQNIGSFCASLLILFSIIYSTISQ
NEIRRFCLQLAMWAVIFLVIITGYAFRFELNYAYRRVMSALIPSYKWSTEVGEIIIARNR
DGHFYINAFVNNVKIKFMVDTGASDIALTKEDAQKLGFDLTKLKYTRTYLTANGENKAAP
ITLNSVVIGKEFKNIKGHVGLGNLDISLLGMSLLERFKGFRIDKDLLILNY
Download sequence
Identical sequences C3PM03
WP_012720107.1.29537 347255.RAF_ORF1225 gi|229587235|ref|YP_002845736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]