SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 347834.RHE_CH02944 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347834.RHE_CH02944
Domain Number 1 Region: 52-190
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.14e-28
Family B3/B4 domain of PheRS, PheT 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 347834.RHE_CH02944
Sequence length 232
Comment (Rhizobium etli CFN 42)
Sequence
MQFSHSDAIWQAFPELAAGALSADGVDASADVEEAIASFSAIAGARLAEAQESEFPEIQA
WRRGFSRMGLKPTQYRSASEALLRRFRQEHALPRLHPLVDLCNAVSLAFAIPVAVFDTEK
IAGDLQVRHATGHETYLTFSGQSEHPEPGEVIFADDEGRAHARRWTNRQSGLSAVRETTG
SVLIVAEALHAGAGEDAASLVATLADAFARHWSVTAATAALSQASPRFAFQL
Download sequence
Identical sequences Q2K625
347834.RHE_CH02944 WP_011426187.1.62937 gi|86358546|ref|YP_470438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]