SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 347834.RHE_CH03558 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  347834.RHE_CH03558
Domain Number - Region: 94-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00353
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 347834.RHE_CH03558
Sequence length 151
Comment (Rhizobium etli CFN 42)
Sequence
MLAKIIAELGPWNWWVTGLVLLAAEMIVPGFFLVWIGLAALIVGALSLLFWDSAFWIWEI
QAILFALLAVATTFAGRRLTLRNAETDEPFLNQRGASLVGRTATLQEPIREGRGRIRLDD
TLWQVMGPDLPVGTQVKVISCHGRDLRVEPV
Download sequence
Identical sequences Q2K4C2 S5RZR0
347834.RHE_CH03558 WP_011426776.1.62937 WP_011426776.1.76939 gi|86359149|ref|YP_471041.1| gi|528830331|ref|YP_008366287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]