SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 347834.RHE_PC00076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347834.RHE_PC00076
Domain Number 1 Region: 14-202
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.61e-22
Family Clp protease, ClpP subunit 0.045
Further Details:      
 
Domain Number 2 Region: 381-440
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000981
Family NfeD domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 347834.RHE_PC00076
Sequence length 446
Comment (Rhizobium etli CFN 42)
Sequence
MLLFLLLSAWVFGVPSASDRVSVVLKVNGAIGPAIADYVIRGIQRAGEREAVLIVLQMDT
PGGLDTSMREIIRAILASPVPVASFVAPSGARAASAGTYILYASHIAAMAPGTNLGAATP
IALGVKPFGGDEEPEKKPSEPSGKQAEAPGNAHEAKAVNDAVAYIRGLAELRNRNAEWAE
RAVREAASLSSTAAVREHVIDFTAVDINDLLAKAQGRMVRVGQTDLRLDTAGLAVQEFEP
DWRTRLLSVITDPNIAIILMMVGIYGLIFEFLAPGTMLPGTIGGICLLLGLYALALLPVS
FAGLGLIFLGVGLTVAEAHSPSFGAFGIGGGIAVILGATILFDTDIPGLEVSRPLLGAIA
VATLAFSLVVARLAFTSRLRQVTTGAEEMIGISGRVESWTGLTGYVIAHGERWKAVSAEP
LVAGDPVRVTGRNGLALEVASRPKNT
Download sequence
Identical sequences Q2K1C3
gi|86360121|ref|YP_472010.1| 347834.RHE_PC00076 gi|86360121|ref|YP_472010.1|NC_007764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]