SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 347834.RHE_PE00430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347834.RHE_PE00430
Domain Number 1 Region: 183-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.55e-69
Family D-glucarate dehydratase-like 0.0000000657
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.47e-39
Family Enolase N-terminal domain-like 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 347834.RHE_PE00430
Sequence length 425
Comment (Rhizobium etli CFN 42)
Sequence
MTRITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILATDVPGLAGHGLTFTIGRGND
ICCMAIEAMRHLVVGADLGDVLAHPGKFWRHLTSDSQLRWIGPEKGAMHLATGAVVNAVW
DLLAKQAGKPVWRLVADMSPEEIADIVDYRYLTDVLTRDEAVAILKKAEAGKAQRIAILE
KEGYACYTTSAGWLGYEDEKLRRLCQEAIDSGFNHIKMKVGRDLQDDIRRLRIAREVIGP
DRYLMIDANQVWDVGQAIDWVKALAFAKPFFIEEPTSPDDIAGHRKIRQAISPVKVATGE
MCQNRVMFKQFIAEGAIDIVQIDSCRMGGLNEVLSVLLIAAKFGLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKEGRVIEYVDHLHEHFLDPCRIENAAYMPPTLPGFSIEMKPTSISE
YTFRS
Download sequence
Identical sequences Q2JZW8
gi|86360704|ref|YP_472592.1|NC_007765 WP_011428283.1.62937 gi|86360704|ref|YP_472592.1| 347834.RHE_PE00430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]