SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 347834.RHE_PF00229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347834.RHE_PF00229
Domain Number 1 Region: 99-375
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.54e-63
Family D-glucarate dehydratase-like 0.00036
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.53e-28
Family Enolase N-terminal domain-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 347834.RHE_PF00229
Sequence length 396
Comment (Rhizobium etli CFN 42)
Sequence
MMKIDRMRVFMTRDKDRPRVIVALDTDDGLTGWGECYNHGPDKALPPLLDYLYGFLSGQD
PTRVEYLVNLLIQQSRFPPGALGLAAISALDHCLWDLAAKAANVPVYKLLGGEVRDRIKV
YAGVYTAPDAPAARDEFDRLKEEWGFTAFKLSPWRIDMHAHRWGNVVKASADYFRSLRET
VNDEYEIAFDAHAKIFEPIAARQLGNALAPYDPLFYEEPLRPENIEAWGDLKQGLNCVLA
TGESLYNRNEFLRLLQVKGADLIQPDICVVGGISEMRRIATLAEAYFVGVAPHNPMGPLA
TAVNVHFSAAAQNFRILEYRLPKGQAYVYGGLDIEKRQGETRYVVDPYLPKDGYLELRPD
RPGWGVEMDEKAMEEEGYIHWQRRVPKRPDGSYAFA
Download sequence
Identical sequences Q2JZ67
gi|86360959|ref|YP_472846.1| 347834.RHE_PF00229 gi|86360959|ref|YP_472846.1|NC_007766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]