SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 348780.NP1188A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  348780.NP1188A
Domain Number - Region: 89-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0235
Family NfeD domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1188A
Sequence length 215
Comment (Natronomonas pharaonis)
Sequence
MAELLGYSVPFLLVLVGAVLMVMEGFAPGAHFIVVGVALLTAGLVGLLVGGVLPGAALPL
VLAAVVLVAGGAALYGYRQFDFYGGKGSGQTSDSSSLQGQTGRVTQRVTEDDGEIKLDSG
GFNPYYQARALDGEIGEGEKVMVIDPGGGNVVTVEAVSAFEDDIDRELAADRKRKTSNDE
PTPGNESAAASEPESDGGSNEQDHSDDTESESEPA
Download sequence
Identical sequences A0A1U7EUM8
gi|76801246|ref|YP_326254.1| WP_011322321.1.57290 348780.NP1188A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]