SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 348780.NP4046A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP4046A
Domain Number 1 Region: 218-485
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.71e-58
Family PFOR Pyr module 0.056
Further Details:      
 
Domain Number 2 Region: 7-242
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.15e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0047
Further Details:      
 
Domain Number 3 Region: 501-618
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.14e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP4046A
Sequence length 629
Comment (Natronomonas pharaonis)
Sequence
MTEELVWRIAGGSGDGIDSTSQNFAKALMRSGLNVFTHRHYPSRIRGGHTYVEIRAAPEP
VSSRGDGYNFLLALGDSFARNPQEEAYYGDEEVKPLEENLDDLREGGIIVYDEGLVDIDD
IEDFEARVEANDWHVYPLDLRGLARDVGREVMRNTAGVGATAALLEYDLEHVEDLMADAM
SGEVLETNLDILETAYEEVAEMEHTHDLRIPTGSHDEQQVLLSGSNAITYGALDAGCRFI
AGYPMTPWTEVFTLMSQHLPEVGGISEQVEDEIAAAALALGASHAGVKAMSGSSGGGFAL
MSEPLGLAEMTETPLVLVEATRAGPSTGMPTKPEQSDLEHVLYTSQGDSCRVVFAPGNVR
EAYEQTRAAFELAYEYHLPAIVLYDQKLSGELRNVDESFFDREPDADLGATLTEAEIAEA
AHHASGKFNRFQHDPDNDRGVSPRSLPGQTGGRFLATGNEHTEQGHISESPENRVAQLER
RLGKLDAIREELDAADSSHQTYYGPDEAEYGLITFGSQQGTVREAVTRLNDAGHSVRAVS
ISDLMPFPEAEIETFIESVEEAVVVEMTASAQLRGLIQKELGRFGPKLHSLLKYNGNPFE
PQEVVDGFESAIEDEDPAPTTRFVPAAGD
Download sequence
Identical sequences A0A1U7EY28
WP_011323730.1.57290 gi|76802657|ref|YP_330752.1| 348780.NP4046A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]