SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349101.Rsph17029_2233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349101.Rsph17029_2233
Domain Number 1 Region: 443-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.26e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349101.Rsph17029_2233
Sequence length 545
Comment (Rhodobacter sphaeroides ATCC 17029)
Sequence
MRGTSLTFWDHFLPKIVTVFREGYGLRDLRADALAGLTVAIVALPLSTAIAIASGVGPER
GLYTAIVGGFLVSALGGSRFQIGGPAGAFIVLVAACVMQTGIEGLILATFLSGFLLIAMG
TLKLGSYIRFIPYPVTVGFTAGIAVIIAASQMKELLGLTLAGPEPSALVEKVEALWAARE
TITPAALGVAVGTIAMIEGLKRLSPRLPSLLIAIVLASVAVLVLKLPVETIGTRFGELPK
MLPTPALPALDREAILAALPWAVSFTLLGAIESLLSAVVADGMAGTQHRPNAELIAQGWA
NVGSALFGGFCVTGTIARTATNVRAGSRGPVSGMLHALFVLGFLLVAAPLAAYIPLAALA
GLLAVVAWNMFEKEEFWALLRTSRGDAMVVLATFLLVVFRDLTEGIVVGFALGGLVFIRR
MSDAASAEPAQVPEAGGAVTAERVVYRLRGPYFFGAAAMLGSALDRFAERPRAFVLDFAE
VPFIDSSGARSFELLAHKMHRRGGQLFLTGANLEVRRVLLAQGLREPLVRYAPDIAGADA
ILSES
Download sequence
Identical sequences A3PLX0
gi|126462994|ref|YP_001044108.1| 349101.Rsph17029_2233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]