SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349101.Rsph17029_3623 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349101.Rsph17029_3623
Domain Number 1 Region: 97-121,158-393
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.36e-65
Family D-glucarate dehydratase-like 0.0000507
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.25e-27
Family Enolase N-terminal domain-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349101.Rsph17029_3623
Sequence length 404
Comment (Rhodobacter sphaeroides ATCC 17029)
Sequence
MKITAIRTYRVEEFANVLWVHVETDAGVTGLGETFYGAEACEAHIHNTLAVRLLGQNPLN
IELLHKEMVSLPNAQASTGVEYRAASAVDIALWDIFGKVAGQPVHMMLGGQSWDRMRIYN
TCAGTRYVRTNKIKPVDTWNLAAGGAEAPSPYEDLDAFMTRAGELAEDLLSNGITAMKIW
PFDPAAIENKGMFITAEQMKTAIRPFELIRKAVGDRMEIMVEMHSLWNLPVAMDIARALE
PYQPRWFEDAIRMNSPQALAEFARSTTTWTCASETLGSRFAYKEYLDRDATHVVMADLCW
TGGLTEGRKIAAMADTYHRPFAPHDCIGPVGFAAAIHMSISQPNTLIQESVRAFYRGWYR
ELVTEVPRIEGGYVYPMEGPGLGTELVPQFFDRSDLSHRLSEAA
Download sequence
Identical sequences A0A239KSU2 A3PQU7
gi|126464372|ref|YP_001045485.1| WP_011842509.1.39940 WP_011842509.1.46944 349101.Rsph17029_3623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]