SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349101.Rsph17029_4097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349101.Rsph17029_4097
Domain Number 1 Region: 73-346
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-80
Family RecA protein-like (ATPase-domain) 0.0000000628
Further Details:      
 
Domain Number 2 Region: 343-456
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 9.42e-38
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000405
Further Details:      
 
Domain Number 3 Region: 1-71
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000000000000785
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349101.Rsph17029_4097
Sequence length 464
Comment (Rhodobacter sphaeroides ATCC 17029)
Sequence
MTGRVTSVRGPVLDIRVEGPLPAIGDVVEVGSLPVVAEIQAHLGAADVRAIALHSTQGIA
RGETVRTTGGPLRVPTGPAVLGRLLDVAGRPADLGPPIPAEAPRAPILHPAPPLAAQDAR
FQVFSTGIKVLDLLAPLAQGGKTAMFGGAGVGKTVLVMELIRAMVSGYDGISVFAGVGER
SREGHEMLGEMKASGVLDRTVLVYGQMNEPPGARWRVPLTALTIAEGFRDGEGRNVLLLI
DNVFRFVQAGAEVSGLLGRMPSRVGYQPTLETEVAALQERIASVGRASVTAIEAVYVPAD
DFTDPAVTAISAHVDSTVVLSRQLAAEGIYPAIDPLATTSVLLDPAVVGEEHARVAGRLK
EAIEHYHELRDVIALLGIEELGREEQLMVGRARKLQRFLTQPFFVAAAYTGMEGRSVPVA
ETVQGCAAILAGECDDWDEGSLYMIGTLAEARAREEARRRKGAA
Download sequence
Identical sequences A3PS59
349101.Rsph17029_4097 gi|126464835|ref|YP_001041811.1| WP_011840044.1.29994 WP_011840044.1.46944 gi|126464835|ref|YP_001041811.1|NC_009040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]