SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349102.Rsph17025_0262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349102.Rsph17025_0262
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000628
Family Anti-sigma factor antagonist SpoIIaa 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349102.Rsph17025_0262
Sequence length 88
Comment (Rhodobacter sphaeroides ATCC 17025)
Sequence
MNPLKLSGNLRLQDAPGLIERLEAALATGDVEVDASELAGADAAVVQVLLSAARSASMTG
RTLSLQCAGSPLAAQLEALGIAPDGVAA
Download sequence
Identical sequences A4WP58
WP_011907327.1.61369 349102.Rsph17025_0262 gi|146276318|ref|YP_001166477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]