SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349102.Rsph17025_0930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349102.Rsph17025_0930
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.67e-123
Family Enolase 0.0000000239
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.21e-58
Family Enolase N-terminal domain-like 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349102.Rsph17025_0930
Sequence length 425
Comment (Rhodobacter sphaeroides ATCC 17025)
Sequence
MSTIIDIHAREILDSRGNPTVEVDVTLESGAFGRAAVPSGASTGAHEAVEKRDGDTSRYM
GKGVLEAVAAVNGEIAEMLVGFDATDQVGIDRTMIEMDGTPNKGRLGANAILGVSLAVAK
AAAEFTNQPLFRYVGGASARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAKNVRDAIR
MGSEVFHTLKKELAAGGFNTGIGDEGGFAPNISSTRQALDYILRSIEKAGYKPGEDIYLA
LDCASTEYFKGGKYEMKGEGKSLTSAENVDYLAALCADYPIISIEDGCAEDDWDGWKLLT
DRLGAKVQLVGDDLFVTNPKRLEQGIKAGVGNSMLVKVNQIGSLTETLMAVDMAHRARYT
NVMSHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEMLGEVAEYAGR
SILKG
Download sequence
Identical sequences A4WR18
WP_011907973.1.61369 gi|146276978|ref|YP_001167137.1| 349102.Rsph17025_0930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]