SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349124.Hhal_0069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349124.Hhal_0069
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.12e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349124.Hhal_0069
Sequence length 181
Comment (Halorhodospira halophila SL1)
Sequence
MSDRHGVTNIVIAGLGGQGIVTGSDILAHAAFAAGHDVKKSEIHGMSQRGGSVSSDIRFG
PRVHSPMVPHAEADFLIISESSQVLPNRHRLGPQGRLITPDAVPQLFQDESSQQAARMVN
VALLGVLSAHLDIAEAHWIDAIRTQLPEKLHEMNLRAFRQARGIEALFGTLTGDSRPRPT
L
Download sequence
Identical sequences A1WT52
349124.Hhal_0069 gi|121996879|ref|YP_001001666.1| WP_011812887.1.47253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]