SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349124.Hhal_0083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  349124.Hhal_0083
Domain Number - Region: 86-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00615
Family NfeD domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349124.Hhal_0083
Sequence length 145
Comment (Halorhodospira halophila SL1)
Sequence
MFDPSWVWLASGILLLVAAAIFGGHLFLLDLAVAAFVLALVTSMKTDLAVSHQVLIYLLT
TLLLLPAGYRLAQRFAGAYAHRMVAPADAYAGRYGVLVQRGRGVGVLVDDEVFPARGAEG
QELRPGDRVRIERMVGITAWVRPGN
Download sequence
Identical sequences A1WT66
gi|121996893|ref|YP_001001680.1| WP_011812901.1.47253 349124.Hhal_0083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]