SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349124.Hhal_0347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  349124.Hhal_0347
Domain Number - Region: 24-112
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.00235
Family Cation efflux protein transmembrane domain-like 0.042
Further Details:      
 
Domain Number - Region: 107-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0144
Family NfeD domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349124.Hhal_0347
Sequence length 165
Comment (Halorhodospira halophila SL1)
Sequence
MDPMNDPQSLWTVWLTLAVVLLGIEILLAGGAAGVLMALAVMAFAGMAMALFGAPLVAQI
AVAILAGLASLPFMVWVFRRMGRGGGPPSADDSALRRTAFEAYYDARGHLRVRAFGDHLM
AIPDPTDQPEIEPGSAVRIVRLEGTRAIVRPVDAPVGARLDDAQA
Download sequence
Identical sequences A1WTX9
gi|121997156|ref|YP_001001943.1| WP_011813164.1.47253 349124.Hhal_0347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]