SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349124.Hhal_0803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349124.Hhal_0803
Domain Number 1 Region: 30-155
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.15e-23
Family Dual specificity phosphatase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349124.Hhal_0803
Sequence length 182
Comment (Halorhodospira halophila SL1)
Sequence
MKRIRKLWHATVDLLEGAFLNGWQAFFQTVGYYRLIPIEPGVLYRTTEMPPQRLVALCRA
QGVRTVIDLRRKAHRAEAEAAALEPAGIRHVHLPSAQVPDASTVAAFLELMDDPANGPVV
IHCVHGVGRTGALMAVYLMEYRGLDNESARRAAKRIGGFQSFGRGRPKGEFVLHYAPRPR
SA
Download sequence
Identical sequences A1WV67
gi|121997594|ref|YP_001002381.1| WP_011813602.1.47253 349124.Hhal_0803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]