SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349124.Hhal_1437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349124.Hhal_1437
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.53e-126
Family Enolase 0.0000000224
Further Details:      
 
Domain Number 2 Region: 4-135
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.54e-52
Family Enolase N-terminal domain-like 0.00000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349124.Hhal_1437
Sequence length 428
Comment (Halorhodospira halophila SL1)
Sequence
MANIERVIGREVLDSRGNPTVEADVWLDDGSFGRAAVPSGASTGSREAVELRDGGGRYNG
KGVRTAVENVNTTIREALQGGSADDQAALDRQLIDLDGSPNKDRLGANAILAVSMAVAQA
AARSRGLPLYRHLQQEGSAAQLPAPMMNILNGGEHADNSVDIQEFMIMPIGFDRFSEALR
CGAEIFHALKKVLHERGLSTAVGDEGGFAPDLPSNEAALEAIIEAIQRAGYQAGDQVALA
LDVASSELYRDGRYHLASEGRDFDAAGFADYLAQLVDKYPIVSIEDGMDESDWDGWKVLT
ERLGGQIQLVGDDLFVTNPQILQQGIDRGIANSILIKLNQIGTVTETLEAIRMADEAGYT
SVVSHRSGETEDVAIADLAVATRATQIKTGSLCRSDRVAKYNQLLRIEQELGDDARYVGR
DALRPEQG
Download sequence
Identical sequences A1WWZ2
WP_011814226.1.47253 gi|121998219|ref|YP_001003006.1| 349124.Hhal_1437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]