SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349124.Hhal_2116 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349124.Hhal_2116
Domain Number 1 Region: 14-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.34e-16
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349124.Hhal_2116
Sequence length 104
Comment (Halorhodospira halophila SL1)
Sequence
MTRAALENGVDGRWRVTGRLELDTVGALWPQGTALFTAEGGVCEIDLAGVERTDSAGVAL
LIDWTRQARAHGGRLCLCHVPQQLLAIVHASGAEGVLEIADEPA
Download sequence
Identical sequences A1WYW8
gi|121998895|ref|YP_001003682.1| 349124.Hhal_2116 WP_011814902.1.47253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]