SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349161.Dred_0136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349161.Dred_0136
Domain Number 1 Region: 139-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.34e-132
Family Enolase 0.00000000914
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.54e-61
Family Enolase N-terminal domain-like 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349161.Dred_0136
Sequence length 427
Comment (Desulfotomaculum reducens MI-1)
Sequence
MTIISDIFAREILDSRGNPTLEAEVWLEDGTVGRAAVPSGASTGAYEAVELRDGDKGRYL
GKGVLKAVNHVNEILGPELIGMDVTDQIGIDQRMIELDGTPNKGKLGANAILGVSLAVAK
AAANFLGMPLYQYIGGVNAKELPVPMMNILNGGAHADNNVDIQEFMVLPVGADSFSEGLR
MGAEIFHNLKAVLKARGLNTAVGDEGGFAPNLKSNEEALAVIIEAIEKAGYKPGQDVFLG
LDVAATELYKGGNYVLEGEGVTYTSEQMIEFYQRMVEKFPIITIEDGLSEEDWEGWAKLT
QALGKKVQLVGDDLFVTNTERLDKGIKSAVANSILIKLNQIGTLTETLDAIEMAKRAGYT
AVVSHRSGETADTTIADLAVATNAGQIKTGAPSRTDRVAKYNQLLRIEEELSTMAKYRGK
DVFYNLR
Download sequence
Identical sequences A4J0T3
gi|134298015|ref|YP_001111511.1| WP_011876530.1.64742 349161.Dred_0136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]