SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349161.Dred_2489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349161.Dred_2489
Domain Number 1 Region: 104-167
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000235
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349161.Dred_2489
Sequence length 171
Comment (Desulfotomaculum reducens MI-1)
Sequence
MLFYLAQMSGWLATLAFVLGVLALVIELFFVPGFGVAGVVGVILLGWGVLLISVDIFHAT
QALTLALLVTLLVLVGGVWLATKFNFWRRVTLSNRQNKEEGYLAPDRQMEKLLGLEGVAA
TPLRPAGSALIEGMKVDVVTEGEFVAPGTHVLVIKVEGTRVVVKTVDRKDI
Download sequence
Identical sequences A4J7E6
gi|134300328|ref|YP_001113824.1| 349161.Dred_2489 WP_011878797.1.64742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]