SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349307.Mthe_1171 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349307.Mthe_1171
Domain Number 1 Region: 6-193
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349307.Mthe_1171
Sequence length 195
Comment (Methanosaeta thermophila PT)
Sequence
MRTSKCDIVIVGVGGQGVILISEIIGRAALKAGLPVRAAETHGMAQRGGSVINHTRLGCI
YGPMVPEGGADLLVALEPAEALRYGRYLSSGGVALVNTKPVLPTTVTTGHFRYPDIEEIL
APLRGVGRVISMNATEIAERAGNSQTANIVMLGAMSRFMPIEEALILDALRDSVPAKYLD
VNLKAFELGKAEVSG
Download sequence
Identical sequences A0B8C9
349307.Mthe_1171 gi|116754475|ref|YP_843593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]