SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349307.Mthe_1582 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349307.Mthe_1582
Domain Number 1 Region: 31-242
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.15e-38
Family Voltage-gated potassium channels 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349307.Mthe_1582
Sequence length 288
Comment (Methanosaeta thermophila PT)
Sequence
MSGKADRCAGTRSLRETIQFYMIDFRTPLGRAIDIAIIALNIMVVVLFVIETYPLPSRIS
LLLWRLEIAIIFIFMIEYILRFYGAPDRWSYVKETYSLIDLVAIMPTLILLVLPIFGVYA
DLRFIHIIRIMAVFRIFRFLRFIAEDHLLFGIISLRMLNVARLVFIVMTIFFISSGLFYF
AESPVNPEVNNFGDAFYFTVVAVSTVGFGDIVPVSGAGRLVTLMMIISGIILIPIQVSRI
LREWISAPRKRHICSGCGQEWHEEDARYCRICGSPLGEESVTSQDAAE
Download sequence
Identical sequences A0B9H8
349307.Mthe_1582 gi|116754874|ref|YP_843992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]