SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349519.LCK_00621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349519.LCK_00621
Domain Number 1 Region: 1-223
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-37
Family GHMP Kinase, N-terminal domain 0.00043
Further Details:      
 
Domain Number 2 Region: 206-329
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.2e-17
Family Phosphomevalonate kinase (PMK) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349519.LCK_00621
Sequence length 339
Comment (Leuconostoc citreum KM20)
Sequence
MTKILIPGKLFLAGEYAITHPGNTALIATTKTGLSVEIESAAQTSVIHSNTITTDWHFNI
TETAIVSTDDWRYVRAAVNIMQAYTTTNQFKPLSNINVNITSNLNSPFGKIGLGSSAAVV
VGIVEAINAQFNLKLPILTRFKLASLAHLHVQKNGSLGDIAAIMYGGVIAYQSPDLSSFR
QNDENWLRPSLANKIWPKLHIAQLPWPPKWQLLLGATLESADTKSALEHFILSKQFITES
QQIVQNLIHTIAQEDYPQLALGLRRNQELLQNSLPTGYITPKLAHLLESLTNIAGKISGA
GFGDNGFAVLQNNAEQLESVWQRYQIVAQPIIISPQKRG
Download sequence
Identical sequences B1MY51
349519.LCK_00621 gi|170016978|ref|YP_001727897.1| WP_004904148.1.20355 WP_004904148.1.5016 WP_004904148.1.75472 WP_004904148.1.79269 WP_004904148.1.90185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]