SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349741.Amuc_1624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349741.Amuc_1624
Domain Number 1 Region: 42-172
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.99e-18
Family Crotonase-like 0.072
Further Details:      
 
Weak hits

Sequence:  349741.Amuc_1624
Domain Number - Region: 418-471
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00327
Family NfeD domain-like 0.016
Further Details:      
 
Domain Number - Region: 320-403
Classification Level Classification E-value
Superfamily Photosystem I subunits PsaA/PsaB 0.0392
Family Photosystem I subunits PsaA/PsaB 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349741.Amuc_1624
Sequence length 478
Comment (Akkermansia muciniphila ATCC BAA 835)
Sequence
MKRIHLLLLALLALFAGAPFRAAAEETFRDRVVVIPVGEDSLTSKQSFGFMNRILKRAQE
EQARAVIFDLNTPGGLAWETSEMMMKSIQPLTIPTYAYVNPRAMSAGALISAACDKIYMA
PVSSIGAAGIITSSGEEMDTVMRKKAESAFWAFTRSVVTEKGYRPEVVKAMMIPSDQEQQ
FGPVKLEKGALLTLTGKEAAARLEDGRPLLAQGTASSVTDLLAQEKVNAPVVTAEPTAFE
RIGLWIAWASPILILLGIGGIYMEFKTPGFGIGGIVAIAAFALFFFGNNIAGNLAGYETA
ALLVLGIVLLCVEFFVIPGTFIAAIAGGVCIFLALFGGMVSSWEWDHIIRDGQWDDVNTL
AAVLGIPLLKLALGLTGGSLLIALLMKYLPDSILMRRVTNATVSGGSAGEAVNIARVQVG
DRGNAVTELKPNGKAMIHGEICEVFSRQGILIKGTPVRVVDIRPFDLVVVKDDSPSGD
Download sequence
Identical sequences A0A1Y3T467 B2UM00
349741.Amuc_1624 gi|187736113|ref|YP_001878225.1| WP_012420659.1.11081 WP_012420659.1.31314 WP_012420659.1.48500 WP_012420659.1.52179 WP_012420659.1.55880 WP_012420659.1.67314 WP_012420659.1.75205 WP_012420659.1.86927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]