SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350054.Mflv_2021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350054.Mflv_2021
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350054.Mflv_2021
Sequence length 112
Comment (Mycobacterium gilvum PYR-GCK)
Sequence
MQQFTEREVDGVVIVAAVGAIDMLTAPQLQEAVAAAARRRPSGLVVDLTSVDFLGSAGMQ
VLMETRKGLDGDTRFAVVADGPATSRPLKITGITDYVDLYPSLDVALADLAG
Download sequence
Identical sequences A4T9F0 E6TKW0
350054.Mflv_2021 gi|145222609|ref|YP_001133287.1| gi|315443074|ref|YP_004075953.1| WP_011892910.1.11461 WP_011892910.1.22401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]