SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350054.Mflv_4433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350054.Mflv_4433
Domain Number 1 Region: 717-916
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.81e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 2 Region: 26-237
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.35e-16
Family Pyruvate oxidase and decarboxylase PP module 0.071
Further Details:      
 
Domain Number 3 Region: 433-611
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000751
Family PFOR PP module 0.059
Further Details:      
 
Domain Number 4 Region: 281-405
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000157
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350054.Mflv_4433
Sequence length 1148
Comment (Mycobacterium gilvum PYR-GCK)
Sequence
MTDLDVRPPDPHPYDLDNRYRAGSDAVLLTGVQAIARALVEQHERDARAGRRVATFVSGY
QGSPLGGVDRMLYGMPDVLQAHDIVFVPGLNEELAATSVWGSQAELPAGTPTHDGVVGVW
YGKGPGLDRATDALRHANMYGANARGGMVLLVGDDPASKSSTVPAVSERSLAALGIPVLF
PRNAREIVTLFLHGVALSRASGCVVAVKIVADVADGAWTVDADDLDLEIVDPEVEWQGKP
FVYRQRPMAAPADSLLAEADLYGPRAEMVQAYSSANRLDVVEIDPPDARIGIAAAGTTFD
SLRQALTDLGADDSALRAAGVRLLRIGMVSPLCADTVLGFASGLDEILVVEDKTAFVEAQ
MREILYGATNPPRMMGKKDAAGRSLIPADGELTAGRLLAPLRRVLGDRLELRKPPPPALP
LEVLPTRRTAYFCSGCPHNRSTAVPEGSLAGGGIGCHTMVTMSGRADSAVTGLTQMGGEG
SQWIGQAPFTDIAHLFQNIGDGTYFHSGQLAVQACVAAGVNITFKLLYNEVVAMTGAQHA
EGALGVASLTHKLKLEGVAQVIVCADEPRRHRRRDLAAGTLLWHRDRLDEAQRRLRDVPG
VTVLIYDQHCAADARRQRSRGTLPSRTTRVLINEAVCEGCGDCGVKSNCLSVQPVDTEFG
RKTRIDQTSCNTDYSCLDGDCPSFVTVEVTPGRARKPGSAPTPPPVPDVCVEPVTSTHNV
LLAGIGGTGIVTANQVLATAALRAGYDVESLDQIGLSQKAGPVVSHLRFAADRLEPANRL
TPGTADCILAFDLLAAADEKNLGYGDPATTVSIASTSRTPTGEMVYDASVAYPDTSSLLH
RLGRASRRVQEFDASAAAKTLFGNTAAANFLLIGAAYQAGALRIPAAAIEEAIGINGVAV
ATNVAAFRWGRVAIADPAHFHDVAVPVPAGPVGTAPVHLLAGTGISGRVGDLIARRAADL
IAFQSEAVARRYVSVLQRVWTAERRIGSRTEFSEAAAKGLYKFTAYKDEYEVARLLTHPR
FLAQVRAEFPAGENLTYKVHPPTLRALGRRKKIGLGPRSHVVLRALAAGKRLRGTVFDPF
GYAHVRRVERRLLAEYTDLITGVADTLDEHNYDRAVQVAGLADTVRGYEGVKLASVEVYR
ARLREMGF
Download sequence
Identical sequences A4TDG7
WP_011895276.1.11461 gi|145225012|ref|YP_001135690.1| 350054.Mflv_4433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]